BYKdb

Annotate results for A0A0M9X1L6

A0A0M9X1L6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0M9X1L6
DOMAINcd41/221TSSIAGEGKSTNAANLGVVFAQEGKRVLIIDADMRKPTLHHTFRTLNSSGLSDVLTRQQI
YFNVIQKTSVEGLSVIPSGPLPPNPVELLSSKTMDILMQDLRKDYDIVILDAPPLLSVSD
AQILSNKCDGTLLIVNMDVAQKVDVLKAKATLSSSKAKILGVVLNNIKIPKNHYYYQTYG
S
SITEWalker A48/50GKS
SITEWalker A'68/75LIIDADMR
SITEWalker B148/154VILDAPP
SITEY Cluster214/219YYYQTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKLVTVTDSKSLISEQFRTMRTNIRFSMPDQDIKSLLVTSSIAGEGKSTNAANLGVVFAQEGKRVLIIDADMRKPTLH
                                        TSSIAGEGKSTNAANLGVVFAQEGKRVLIIDADMRKPTLH
                                               GKS                 LIIDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTFRTLNSSGLSDVLTRQQIYFNVIQKTSVEGLSVIPSGPLPPNPVELLSSKTMDILMQDLRKDYDIVILDAPPLLSVSD
HTFRTLNSSGLSDVLTRQQIYFNVIQKTSVEGLSVIPSGPLPPNPVELLSSKTMDILMQDLRKDYDIVILDAPPLLSVSD
                                                                   VILDAPP      
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
AQILSNKCDGTLLIVNMDVAQKVDVLKAKATLSSSKAKILGVVLNNIKIPKNHYYYQTYGS
AQILSNKCDGTLLIVNMDVAQKVDVLKAKATLSSSKAKILGVVLNNIKIPKNHYYYQTYGS
                                                     YYYQTY  
© 1998-2019