BYKdb

Annotate results for A0A0N0FS39

A0A0N0FS39 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N0FS39
DOMAINcd253/441SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAP
SITEWalker A260/262GKS
SITEWalker A'280/287LLIDADMR
SITEWalker B360/366ILIDTPP
SITEY Cluster428/437YDYAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPAVRKQLEDAETALNNFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLI


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQT
            SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQT
                   GKS                 LLIDADMR                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEAC
RVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEAC
                                       ILIDTPP                                  
       410       420       430       440  
....:....|....:....|....:....|....:....|..
KRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
KRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAP 
                           YDYAAYGYNY     
© 1998-2019