BYKdb

Annotate results for A0A0N0K036

A0A0N0K036 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N0K036
DOMAINtad26/199VPPMLLQYWYTVMRWRWLMLGIILGCIVLSVVVTLFMSPQYTAQVQIQIDRQQKQITMVE
GIEAQTTPQDQEFYATQYTLLTARPLAERVAASLALYNNETFLAAHGIDGDVLTEKSPGL
SAQQIKDKNRRLIINLLLDNVDIAPIRNSKLVNVTYTSRDANLSARIANEWAAA
DOMAINcd538/727TSTRPSEGKSSTSMALAIVLGRTGKNVLLIDGDLRSPSIHGMLGMTNEKGLSNYLAGEDD
WQSFIQPTELKNVSIISTGRSPPSAAELLSGDRLASLIAQALTQYDNVVIDAPPVLGMTD
APLIAKAVESVVYVVESVGPAVRGIRSSIQRLVMANARLSGVVLTKVGEGSMNYGYGYGY
GYGYGYGSDR
SITEWalker A545/547GKS
SITEWalker A'565/572LLIDGDLR
SITEWalker B645/651VVIDAPP
SITEY Cluster711/723YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNTENFGALEPQRGYPTTGAIGPSVPPMLLQYWYTVMRWRWLMLGIILGCIVLSVVVTLFMSPQYTAQVQIQIDRQQKQ
                         VPPMLLQYWYTVMRWRWLMLGIILGCIVLSVVVTLFMSPQYTAQVQIQIDRQQKQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITMVEGIEAQTTPQDQEFYATQYTLLTARPLAERVAASLALYNNETFLAAHGIDGDVLTEKSPGLSAQQIKDKNRRLIIN
ITMVEGIEAQTTPQDQEFYATQYTLLTARPLAERVAASLALYNNETFLAAHGIDGDVLTEKSPGLSAQQIKDKNRRLIIN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLDNVDIAPIRNSKLVNVTYTSRDANLSARIANEWAAAFIATSMDRQYASTADARKFLEERLVTLRQRLDESEKLAVNY
LLLDNVDIAPIRNSKLVNVTYTSRDANLSARIANEWAAA                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASRNGIVSLGETRDSEGRTTSNQTLAGAQLAEMASALNEATAARIAAEARSGSAGESTSESVTSNSLSSLRGQRATIAAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAKKRVQLEDGHPTVQELKQQLATTDNAISQETQRISRARQSEYREAARREAELRAKVETLKQGLDVQNKANIQYAAFLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADTNRQIYDALLQRYKEIGVAGQVGVNNISVVEPANAPDRPSSPNLLLNLLIATFLGVALAGATAFGLEQIDEGVRDPT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVDALLGLPLLGITPKVERNATEEMADLKSALYDAYFSIHSNLSFSTSHGFPKSLAVTSTRPSEGKSSTSMALAIVLGRT
                                                         TSTRPSEGKSSTSMALAIVLGRT
                                                                GKS             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKNVLLIDGDLRSPSIHGMLGMTNEKGLSNYLAGEDDWQSFIQPTELKNVSIISTGRSPPSAAELLSGDRLASLIAQALT
GKNVLLIDGDLRSPSIHGMLGMTNEKGLSNYLAGEDDWQSFIQPTELKNVSIISTGRSPPSAAELLSGDRLASLIAQALT
    LLIDGDLR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYDNVVIDAPPVLGMTDAPLIAKAVESVVYVVESVGPAVRGIRSSIQRLVMANARLSGVVLTKVGEGSMNYGYGYGYGYG
QYDNVVIDAPPVLGMTDAPLIAKAVESVVYVVESVGPAVRGIRSSIQRLVMANARLSGVVLTKVGEGSMNYGYGYGYGYG
    VVIDAPP                                                           YGYGYGYGYG
       730  
....:....|..
YGYGSDRKDLDQ
YGYGSDR     
YGY         

© 1998-2019