BYKdb

Annotate results for A0A0N0M5F7

A0A0N0M5F7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N0M5F7
DOMAINcd167/354TSCGKGEGKTSTAYALARDFAQIGRRVLLVDADMRRPSMHKLLSFENNAGLADLLNREKA
IENVVRRTAIADLHFISAGAAEPNPAELLASGTLPWLIGQLEEMYDIVIIDGPPMLGLAD
APSIAVHVEATLFVIDAGQTRRKTIRSALRRLRLSRATLRGVILNRVDVRTLGYGYESYY
RYDEEARR
SITEWalker A174/176GKT
SITEWalker A'194/201LLVDADMR
SITEWalker B274/280VIIDGPP
SITEY Cluster340/348YGYESYYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQGEVERLRNATLSEQDRSIRYTILRREVRTNRELYDGLLQRFKEVSAAAGVSANNISIVDLASTPVRPVAPNLPVNLGL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLAAFVAAIGVIYLRENLDDMLRTVDDAERKLGVTGLGMVPRLDAGVTFRDEVEKRNSSLSEAIHTIRSAIELAGGNGP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRTVFITSCGKGEGKTSTAYALARDFAQIGRRVLLVDADMRRPSMHKLLSFENNAGLADLLNREKAIENVVRRTAIADLH
      TSCGKGEGKTSTAYALARDFAQIGRRVLLVDADMRRPSMHKLLSFENNAGLADLLNREKAIENVVRRTAIADLH
             GKT                 LLVDADMR                                       
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FISAGAAEPNPAELLASGTLPWLIGQLEEMYDIVIIDGPPMLGLADAPSIAVHVEATLFVIDAGQTRRKTIRSALRRLRL
FISAGAAEPNPAELLASGTLPWLIGQLEEMYDIVIIDGPPMLGLADAPSIAVHVEATLFVIDAGQTRRKTIRSALRRLRL
                                 VIIDGPP                                        
       330       340       350       360  
....:....|....:....|....:....|....:....|..
SRATLRGVILNRVDVRTLGYGYESYYRYDEEARRPRSWLGRR
SRATLRGVILNRVDVRTLGYGYESYYRYDEEARR        
                   YGYESYYRY              
© 1998-2019