BYKdb

Annotate results for A0A0N0RC34

A0A0N0RC34 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N0RC34
DOMAINtad9/172APPLVLQYWNIALRWKYVIAGILIVALAVGVLATFIATPQYSSEVQVEITRDQKNPTHAE
GIESAQSSQEAEFYQTQYTLLESRSLAERVARQLNLGGNKEFYDAHSLDFAPSDDVRARV
QAASKILLANIEISPIARSRLVNIRYTSASPELSAKIANAWADN
DOMAINcd508/699TSTSPGEGKSTTSFSLALVLARTGKRTLLIDADMRSPSVHGFAGIENEKGLSNLLAGEDN
WQAMVQRADLGVERLEFLTAGPNPPSAAELLSSDRMSLLIRDLLEQYDHVVVDAPPLLGL
ADVPLLSRAVEGSVFVVAAGQVAVRALRGSLSRLHQAHARIFGVVLTKLAPQNSLSGYGY
GYGYGYRYGGEP
SITEWalker A515/517GKS
SITEWalker A'535/542LLIDADMR
SITEWalker B617/623VVVDAPP
SITEY Cluster685/695YGYGYGYGYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPQASDDNAPPLVLQYWNIALRWKYVIAGILIVALAVGVLATFIATPQYSSEVQVEITRDQKNPTHAEGIESAQSSQEAE
        APPLVLQYWNIALRWKYVIAGILIVALAVGVLATFIATPQYSSEVQVEITRDQKNPTHAEGIESAQSSQEAE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FYQTQYTLLESRSLAERVARQLNLGGNKEFYDAHSLDFAPSDDVRARVQAASKILLANIEISPIARSRLVNIRYTSASPE
FYQTQYTLLESRSLAERVARQLNLGGNKEFYDAHSLDFAPSDDVRARVQAASKILLANIEISPIARSRLVNIRYTSASPE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSAKIANAWADNFIQASMDRRFGATQDARAFLERRLLEYTKKLEDAERRAALFAANSGIVVLSSSTDADGNSGIQKTLVS
LSAKIANAWADN                                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDLENMSNELAKATADRIAKQAAATEARALASQNQTVGLLRQRRAEANAEYSELLAHYEPGYPAAQALKQKVAALDAAIA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEEGRSVRSVRGEYDEAVKREANIRANVEKLKDDIELQNRDSIQYNIYRRDADATRQLYDSLLQRTKEIGVASVAANNIA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDRADVATSPTSPSLITNLMIALIIGLALALLAVMALEQIDEGLREPADVRRLLELPLLGAIPDQLNDEPLDLLLDPKS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NISEAYLSVRTNLAFTTDHGVPRSVVVTSTSPGEGKSTTSFSLALVLARTGKRTLLIDADMRSPSVHGFAGIENEKGLSN
                           TSTSPGEGKSTTSFSLALVLARTGKRTLLIDADMRSPSVHGFAGIENEKGLSN
                                  GKS                 LLIDADMR                  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLAGEDNWQAMVQRADLGVERLEFLTAGPNPPSAAELLSSDRMSLLIRDLLEQYDHVVVDAPPLLGLADVPLLSRAVEGS
LLAGEDNWQAMVQRADLGVERLEFLTAGPNPPSAAELLSSDRMSLLIRDLLEQYDHVVVDAPPLLGLADVPLLSRAVEGS
                                                        VVVDAPP                 
       650       660       670       680       690       700     
....:....|....:....|....:....|....:....|....:....|....:....|....:
VFVVAAGQVAVRALRGSLSRLHQAHARIFGVVLTKLAPQNSLSGYGYGYGYGYRYGGEPAEQTNS
VFVVAAGQVAVRALRGSLSRLHQAHARIFGVVLTKLAPQNSLSGYGYGYGYGYRYGGEP      
                                            YGYGYGYGYRY          

© 1998-2019