BYKdb

Annotate results for A0A0N0XAV4

A0A0N0XAV4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N0XAV4
DOMAINcd184/372SSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAARRR
CADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTD
ASLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAA
YGYDYKSAP
SITEWalker A191/193GKS
SITEWalker A'211/218LLIDADMR
SITEWalker B291/297ILVDTPP
SITEY Cluster359/368YDSAAYGYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDILRAGSIGNVRVIDHANANTEKPVKPMKKL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVLMATLIGALVAVMIIFVRQAFYRGVESAEVIEGLGMPVYASLPYSRQQDRLEKNSKSAPTRPGTRLLSAAAPDDLAIE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAA
                       SSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAA
                              GKS                 LLIDADMR                      
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTDASLVGRQAGTCLMVARF
RRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTDASLVGRQAGTCLMVARF
                                                  ILVDTPP                       
       330       340       350       360       370   
....:....|....:....|....:....|....:....|....:....|...
GMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAPR
GMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAP 
                                      YDSAAYGYDY     
© 1998-2019