BYKdb

Annotate results for A0A0N1ARZ5

A0A0N1ARZ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N1ARZ5
DOMAINtad32/201DRIDLRRLMAMFRRRIGVFLGVLLGVLAIGMVITALQPRTYQARAEVTLNSKLQPVAPTS
TNDRTDQPAIPSESFVDTQVSVITSETNTAAVADALGLARDPRFAPSPDEGKAANTKSAG
AHQSAREAAIAYLAKNVAAQRIGTTYGIAITFESSDPQEAARIANAFAEQ
DOMAINcd543/734TSALPEEGKTTTSICLARSMAAAGDRILLIDGDLRHQGVSRFLRGGEGRPGLMEVLHGTA
SLDDALVVDPGTGLSILPLCAEAGDRAELMTGVEMDRLLATARERFDAVIIDTAPVLPIA
DARLLLGKADASVFVVRWRKTPEQALRAALRLLPIDRVQLAGVALTRVDMRKQPRFDYGE
TAFYRSYESYYA
SITEWalker A550/552GKT
SITEWalker A'570/577LLIDGDLR
SITEWalker B651/657VIIDTAP
SITEY Cluster720/733YGETAFYRSYESYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNTAIDFYRAPAGIVPATPAEPRANSAAATDRIDLRRLMAMFRRRIGVFLGVLLGVLAIGMVITALQPRTYQARAEVTL
                               DRIDLRRLMAMFRRRIGVFLGVLLGVLAIGMVITALQPRTYQARAEVTL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSKLQPVAPTSTNDRTDQPAIPSESFVDTQVSVITSETNTAAVADALGLARDPRFAPSPDEGKAANTKSAGAHQSAREAA
NSKLQPVAPTSTNDRTDQPAIPSESFVDTQVSVITSETNTAAVADALGLARDPRFAPSPDEGKAANTKSAGAHQSAREAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAYLAKNVAAQRIGTTYGIAITFESSDPQEAARIANAFAEQYTLGALENKRSGARETTGVIANRLEQLRQQALADSATVQ
IAYLAKNVAAQRIGTTYGIAITFESSDPQEAARIANAFAEQ                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYRIAHNLLSTTQGTLTEQEISSYNQEVTAARAQASEDAARLEAAQRQLQAGGSGGVGEASLSPVIGQMRAQQASLAAEF


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAMSSRYGPQHPEVLRSKAQLDAVNRQIAAETQRVMASLEAKARVSQQRLASLAGSLDASRGALAQNNAAQVGLDDLQKR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AETSNALYESYLNRFKELTAREGTEQADADLLHRADVPRNPNSPHIMINAVLALALGTGLGIAAAFLAEMTFTGLTTGED


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEERMGVRYLCAIPTLQSVARRGERVPASALLEDPRSVFAESFRSLRASIAMNTTEARIIAITSALPEEGKTTTSICLAR
                                                              TSALPEEGKTTTSICLAR
                                                                     GKT        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMAAAGDRILLIDGDLRHQGVSRFLRGGEGRPGLMEVLHGTASLDDALVVDPGTGLSILPLCAEAGDRAELMTGVEMDRL
SMAAAGDRILLIDGDLRHQGVSRFLRGGEGRPGLMEVLHGTASLDDALVVDPGTGLSILPLCAEAGDRAELMTGVEMDRL
         LLIDGDLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATARERFDAVIIDTAPVLPIADARLLLGKADASVFVVRWRKTPEQALRAALRLLPIDRVQLAGVALTRVDMRKQPRFDY
LATARERFDAVIIDTAPVLPIADARLLLGKADASVFVVRWRKTPEQALRAALRLLPIDRVQLAGVALTRVDMRKQPRFDY
          VIIDTAP                                                              Y
       730    
....:....|....
GETAFYRSYESYYA
GETAFYRSYESYYA
GETAFYRSYESYY 

© 1998-2019