BYKdb

Annotate results for A0A0N1BHQ7

A0A0N1BHQ7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N1BHQ7
DOMAINtad9/177PLFDIREIIATIRANLIVISAIVAASLALAVIVTMLQTLRYTAQTTLQINDQSAQILGKQ
DDTLQDPVVAASDTERFLQTQVDILKSRALTERVAQRLRLVGNARFYDAMGVRQPTGDLS
RAEVKDLTIRTIEAARDVDLPRNTRLATVSFVSTQPELAAQIANAFAAE
DOMAINcd521/716TSSQPSEGKSTTSLAIAKGIARLGRSVVLLDVDLRRPALHRTIPMLNGENELGVTSILTA
QSTVEEALRDTDVDHLKIITSGPIPPSPTELISSKRMTQLIEELSEKFDLVLLDSPPVLG
LADSPLMAALVDGVVIVIQSDRSRRGSLKASLRRLRSMRTNILGAALTKFDPNDAGNRYS
EYYGYNYYHYSNSAAN
SITEWalker A528/530GKS
SITEWalker A'548/555VLLDVDLR
SITEWalker B631/637VLLDSPP
SITEY Cluster699/710YSEYYGYNYYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDPYADGKPLFDIREIIATIRANLIVISAIVAASLALAVIVTMLQTLRYTAQTTLQINDQSAQILGKQDDTLQDPVVAAS
        PLFDIREIIATIRANLIVISAIVAASLALAVIVTMLQTLRYTAQTTLQINDQSAQILGKQDDTLQDPVVAAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTERFLQTQVDILKSRALTERVAQRLRLVGNARFYDAMGVRQPTGDLSRAEVKDLTIRTIEAARDVDLPRNTRLATVSFV
DTERFLQTQVDILKSRALTERVAQRLRLVGNARFYDAMGVRQPTGDLSRAEVKDLTIRTIEAARDVDLPRNTRLATVSFV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STQPELAAQIANAFAAEFIQTNLQRRFDSSAYAREFISGQLAEARAKLERSERELNAYARDAGLIRDRDASTGAQSSRVG
STQPELAAQIANAFAAE                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSVTTTSLLEVNSTANQAQANRIAMEGRWTLISRGNPLDSPDVLANPAVSQLLAERARNMSELEKQRANHLEDYPAVQQL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAQVGVIDAQIQNVARSIRASVKQQYDAAVDAEKSLKRQVAELKSSSLAEQDQLVQYRLLEREADTNRTVYEGLLQRYKE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNAAAGISASNIAIIDTAVAPIRPSSPNLLRNLLLALVLGIISSAIVIYLRTLLDDSVKVPEDVEGKLQLPLLGVIPLAQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELEINLAMEDPKSPISEGYNSLRSALLYSTAAGLPKTLLVTSSQPSEGKSTTSLAIAKGIARLGRSVVLLDVDLRRPALH
                                        TSSQPSEGKSTTSLAIAKGIARLGRSVVLLDVDLRRPALH
                                               GKS                 VLLDVDLR     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTIPMLNGENELGVTSILTAQSTVEEALRDTDVDHLKIITSGPIPPSPTELISSKRMTQLIEELSEKFDLVLLDSPPVLG
RTIPMLNGENELGVTSILTAQSTVEEALRDTDVDHLKIITSGPIPPSPTELISSKRMTQLIEELSEKFDLVLLDSPPVLG
                                                                      VLLDSPP   
       650       660       670       680       690       700       710      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
LADSPLMAALVDGVVIVIQSDRSRRGSLKASLRRLRSMRTNILGAALTKFDPNDAGNRYSEYYGYNYYHYSNSAAN
LADSPLMAALVDGVVIVIQSDRSRRGSLKASLRRLRSMRTNILGAALTKFDPNDAGNRYSEYYGYNYYHYSNSAAN
                                                          YSEYYGYNYYHY      

© 1998-2019