BYKdb

Annotate results for A0A0N1C074

A0A0N1C074 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N1C074
DOMAINtad17/172DRVDLRLLLAVFRRRLGVFLAVLFAVLAAGLLLTALQPRTYTARAEVTLNSRPQAVAPTS
TSDGPQQAAIPSEGYVDTQVAVVTSEANLAAVADSLGLAKDARFAKSPAGAQAAALAWLR
KGVVAIRIGTTYGIAITFEDTDPALAARVANMFAQQ
DOMAINcd515/706TSALPDEGKTTTSICLARSMALSGDKVLLIDGDLRRQGVSRFLRGDAGRPGLLDVLGGKA
SLEAALVVDPATGLNILPLAEGSDKAPELLTGTEMDRMLDAAREMFDAIIIDTAPVLPIA
DARLMLRKADASVFVVRWRKTPEAALRSALRLLPDDRVQLAGVALTRVDMRKQARFGYGD
DAFYHSYKRYYA
SITEWalker A522/524GKT
SITEWalker A'542/549LLIDGDLR
SITEWalker B623/629IIIDTAP
SITEY Cluster692/705YGDDAFYHSYKRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAPAVAFETRVPPPAADRVDLRLLLAVFRRRLGVFLAVLFAVLAAGLLLTALQPRTYTARAEVTLNSRPQAVAPTSTSDG
                DRVDLRLLLAVFRRRLGVFLAVLFAVLAAGLLLTALQPRTYTARAEVTLNSRPQAVAPTSTSDG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQQAAIPSEGYVDTQVAVVTSEANLAAVADSLGLAKDARFAKSPAGAQAAALAWLRKGVVAIRIGTTYGIAITFEDTDPA
PQQAAIPSEGYVDTQVAVVTSEANLAAVADSLGLAKDARFAKSPAGAQAAALAWLRKGVVAIRIGTTYGIAITFEDTDPA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAARVANMFAQQYTAGALEAKRKTARATTTAIAERLEQLRQQALGDTAAVQRYRITNNLLSTTMGSLTEQEISSYNQAVT
LAARVANMFAQQ                                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TARAAASEDGARLDAARRQLALGTSAGGVGEVSASPAIGSLRAQQATAATELASLTARYGPRHPDVLRAKAALGAIDDRI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADETQRVISSLEARARVSQQRLASLTGSLQQSRGTLAQNNAAMVGLQDLEKRAETSNALYESYLNRFKELTAREGTEQAD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLLHPAAVPLRPTSPNVALNLVLSVALGLGLGVAAAFAAEMTFSGLTTGDDIEQRLGVRYLGSIPTLGSVWRGDEKVPM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALLEDPRSAFAESFRSLRASIAMNTTQARIIALTSALPDEGKTTTSICLARSMALSGDKVLLIDGDLRRQGVSRFLRGD
                                  TSALPDEGKTTTSICLARSMALSGDKVLLIDGDLRRQGVSRFLRGD
                                         GKT                 LLIDGDLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGRPGLLDVLGGKASLEAALVVDPATGLNILPLAEGSDKAPELLTGTEMDRMLDAAREMFDAIIIDTAPVLPIADARLML
AGRPGLLDVLGGKASLEAALVVDPATGLNILPLAEGSDKAPELLTGTEMDRMLDAAREMFDAIIIDTAPVLPIADARLML
                                                              IIIDTAP           
       650       660       670       680       690       700      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
RKADASVFVVRWRKTPEAALRSALRLLPDDRVQLAGVALTRVDMRKQARFGYGDDAFYHSYKRYYA
RKADASVFVVRWRKTPEAALRSALRLLPDDRVQLAGVALTRVDMRKQARFGYGDDAFYHSYKRYYA
                                                   YGDDAFYHSYKRYY 

© 1998-2019