BYKdb

Annotate results for A0A0N1C9H8

A0A0N1C9H8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N1C9H8
DOMAINtad22/193ETRSLGSYLEIVRRQFPTILAIMSSVVILALLFLFTAAPRYTSTASMVIDTRKVQLFQQQ
MLGDVAVDPATVLTQIEMLKSENVSQAVIRNFHLTEDPEFIGSGIVGRLLSFIGLSSGRK
SASELELNRRALQRFERSREIKRVGLTYVMGISFTSRDPAKAARIANAIADA
DOMAINcd552/746TSTMPSEGKSTVSSNLAQLMAHGGAKVILVDADLRNPSLSASLAPDAAAGLVDVVAQRAN
LEDVIQIDPATQLAILPAGSTSQLLHTNEILSSKAMQALVSDLRSKYDYVVLDLPPLAPV
VDARVTSNYVDSYVFVVEWGKTKPDVIQHTLRSAPGIVDKILGVVLNKADTRMLARYESY
QGRHYYQKYYARYGY
SITEWalker A559/561GKS
SITEWalker A'579/586ILVDADLR
SITEWalker B661/667VVLDLPP
SITE-658/-684YDYVVLDLPPLAPVVDARVTSNYVDSY
SITE-691/-693GKT
SITEY Cluster728/746YESYQGRHYYQKYYARYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQQNKSTQEINRGPAELEGGETRSLGSYLEIVRRQFPTILAIMSSVVILALLFLFTAAPRYTSTASMVIDTRKVQLFQQ
                     ETRSLGSYLEIVRRQFPTILAIMSSVVILALLFLFTAAPRYTSTASMVIDTRKVQLFQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QMLGDVAVDPATVLTQIEMLKSENVSQAVIRNFHLTEDPEFIGSGIVGRLLSFIGLSSGRKSASELELNRRALQRFERSR
QMLGDVAVDPATVLTQIEMLKSENVSQAVIRNFHLTEDPEFIGSGIVGRLLSFIGLSSGRKSASELELNRRALQRFERSR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIKRVGLTYVMGISFTSRDPAKAARIANAIADAYIVDQLEAKYEATRRASVWLQDRIKELRIQASAARRAVVDFKTANNI
EIKRVGLTYVMGISFTSRDPAKAARIANAIADA                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDTGKGLMTDQQIAEVNSQLVLAHASTAEANARLERMTEILKQGVPDASVADALKNDTIVKLRGQYVDMASKESIWTAKY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GADHLAVLNLRTQMAEIRKNIVDELKRIRESYKSDYDIAVTREESIKASLANAVSESQSSNQAQIQLRDLDSSAQSYQAM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDNFLQRYMESVQQQSFPITEARVISSASTPLGKSYPNTMVILALAVLGGLILGLAAAIAREFSDRVFRTSGQVEEQLGT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NCLAILPLLGNDAAKPVLPWKAKAKTGSRKSKEFLRYVVDNPLSRFSEALRSIKVAIDLNSFVRENRVLATTSTMPSEGK
                                                                       TSTMPSEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVSSNLAQLMAHGGAKVILVDADLRNPSLSASLAPDAAAGLVDVVAQRANLEDVIQIDPATQLAILPAGSTSQLLHTNE
STVSSNLAQLMAHGGAKVILVDADLRNPSLSASLAPDAAAGLVDVVAQRANLEDVIQIDPATQLAILPAGSTSQLLHTNE
S                 ILVDADLR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILSSKAMQALVSDLRSKYDYVVLDLPPLAPVVDARVTSNYVDSYVFVVEWGKTKPDVIQHTLRSAPGIVDKILGVVLNKA
ILSSKAMQALVSDLRSKYDYVVLDLPPLAPVVDARVTSNYVDSYVFVVEWGKTKPDVIQHTLRSAPGIVDKILGVVLNKA
                    VVLDLPP                                                     
       730       740        
....:....|....:....|....:...
DTRMLARYESYQGRHYYQKYYARYGYAE
DTRMLARYESYQGRHYYQKYYARYGY  
       YESYQGRHYYQKYYARYGY  

© 1998-2019