BYKdb

Annotate results for A0A0N1CLC9

A0A0N1CLC9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N1CLC9
DOMAINcd54/234TSSGPGEGKSTTSANLAVVFAKSGQRVLLVDADMRKPTVYKTFNLSNASGLSTVLSTSTS
VLEVAQKTVIDNLSVLTSGPKPPNPSELLGSTRMNQVMEEAKNLYDVVIFDMPPVVAVTD
AQIMASKADGTIVVVRENVSRKESLSKAKELLNMVQARVLGVVYNGAENSKDSSYYYYYG
N
SITEWalker A61/63GKS
SITEWalker A'81/88LLVDADMR
SITEWalker B161/167VIFDMPP
SITEY Cluster228/232YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKQERKATQTHAVSLITLVDPSSPIAEQYRTIRTNIQFASSADRRIQTIVITSSGPGEGKSTTSANLAVVFAKSGQRV
                                                     TSSGPGEGKSTTSANLAVVFAKSGQRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRKPTVYKTFNLSNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSTRMNQVMEEAKNLYDV
LLVDADMRKPTVYKTFNLSNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSTRMNQVMEEAKNLYDV
LLVDADMR                                                                        
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
VIFDMPPVVAVTDAQIMASKADGTIVVVRENVSRKESLSKAKELLNMVQARVLGVVYNGAENSKDSSYYYYYGN
VIFDMPPVVAVTDAQIMASKADGTIVVVRENVSRKESLSKAKELLNMVQARVLGVVYNGAENSKDSSYYYYYGN
VIFDMPP                                                            YYYYY  
© 1998-2019