BYKdb

Annotate results for A0A0N1CRX6

A0A0N1CRX6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N1CRX6
DOMAINcd49/228TSSGAGEGKSTTSANLAVVFANSGKRVLLVDADLRKPTVALTFRLPNHRGLSTLIADREG
QLEQHIQESGVENLSILTSGPIPPNPSELLQSQRMTDLIPELTRQFDLIIFDMPPIGVVT
DAQILASKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
SITEWalker A56/58GKS
SITEWalker A'76/83LLVDADLR
SITEWalker B157/163IIFDMPP
SITEY Cluster224/227YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKNTNLSPVSLMTVANTNSVIAEQLRTIRSNINFSSVDKELQSMVITSSGAGEGKSTTSANLAVVFANSGKRVLLVDA
                                                TSSGAGEGKSTTSANLAVVFANSGKRVLLVDA
                                                       GKS                 LLVDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPTVALTFRLPNHRGLSTLIADREGQLEQHIQESGVENLSILTSGPIPPNPSELLQSQRMTDLIPELTRQFDLIIFD
DLRKPTVALTFRLPNHRGLSTLIADREGQLEQHIQESGVENLSILTSGPIPPNPSELLQSQRMTDLIPELTRQFDLIIFD
DLR                                                                         IIFD
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
MPPIGVVTDAQILASKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
MPPIGVVTDAQILASKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
MPP                                                            YYYY 
© 1998-2019