BYKdb

Annotate results for A0A0N1IZI9

A0A0N1IZI9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N1IZI9
DOMAINcd59/239TSSDPSEGKSTFSANLAVTYAKQGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNST
IEDAIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFNKPNDLVIVDVPPVNTMTD
ASIVSTTVDGTIFVLPQGVAEKKRVKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYS
K
SITEWalker A66/68GKS
SITEWalker A'86/93VLVDADMR
SITEWalker B166/172VIVDVPP
SITEY Cluster233/237YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSIMVTSSDPSEGKSTFSANLAVTYAK
                                                          TSSDPSEGKSTFSANLAVTYAK
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDAIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDAIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
     VLVDADMR                                                                   
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRVKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRVKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
     VIVDVPP                                                            YYYYY  
© 1998-2019