BYKdb

Annotate results for A0A0N1LT16

A0A0N1LT16 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N1LT16
DOMAINtad36/204NLISLETIRGLAFRQRNLLIGVILAVLVLSLVATLMTKPVYQASATVQVDSSQANIVEGQ
DLEPAMRGGEFSRYMSTQGAVIMSKRMAYQVVDTLKLADNDELLGDAATTRPANLSDEKW
KARRREIAAAILKGGVSVVVPDDIRILTISFKSENPRLAASIANAYVDN
DOMAINcd548/740TSSQPSEGKTLTATVLARKYAELGHKTLLIDADLRKPTVSAMFGATKRPTQGFVEVLLGD
IDLQSALIKGTIDNLSVLPVGSIPHNPVEILSSPRLAEFIQKCRGDYALIMIDSAPVMGL
ADAPLVSRLVDGVVFIVEANRSNFGQTKTALRRLRSVGANVLGVVLTKYRSAEAGLSYDY
HYNYYSYGHGKKD
SITEWalker A555/557GKT
SITEWalker A'575/582LLIDADLR
SITEWalker B657/663IMIDSAP
SITEY Cluster725/734YDYHYNYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEKVQARMSEANSRESWVDQYLPRTDGAAIDRTGNLISLETIRGLAFRQRNLLIGVILAVLVLSLVATLMTKPVYQASA
                                   NLISLETIRGLAFRQRNLLIGVILAVLVLSLVATLMTKPVYQASA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVQVDSSQANIVEGQDLEPAMRGGEFSRYMSTQGAVIMSKRMAYQVVDTLKLADNDELLGDAATTRPANLSDEKWKARRR
TVQVDSSQANIVEGQDLEPAMRGGEFSRYMSTQGAVIMSKRMAYQVVDTLKLADNDELLGDAATTRPANLSDEKWKARRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIAAAILKGGVSVVVPDDIRILTISFKSENPRLAASIANAYVDNFVLEDTRRGIEISTYAQNYLTTQIREIGNKLQNAEM
EIAAAILKGGVSVVVPDDIRILTISFKSENPRLAASIANAYVDN                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AANAYAKANGIIATTAPAAGDTNGASPPATITVATLGTVSGTYTETRNRRIAAEQRWRNAQGLAASQLPEVQANNAIQAL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAERSKVAAQISELRQRYGENYPQVSEARATLTSLDSQITRLSTDVKNSIRDQYQLALRQEEALSGELKKVSGDTLDEQD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRVRYNLLDREAAALRTQLAALLDRYNQVAAAANIQQGAITKVDDASVPGAPISPNLTKNLLAAMVVGIGLAVALAVLRD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLDDRLRSVDDVERKLGTPLLGFTPNVESMDVEAQVADPFSALMESYSSLRTSLDFAQSGDNRVLMVTSSQPSEGKTLTA
                                                                   TSSQPSEGKTLTA
                                                                          GKT   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVLARKYAELGHKTLLIDADLRKPTVSAMFGATKRPTQGFVEVLLGDIDLQSALIKGTIDNLSVLPVGSIPHNPVEILSS
TVLARKYAELGHKTLLIDADLRKPTVSAMFGATKRPTQGFVEVLLGDIDLQSALIKGTIDNLSVLPVGSIPHNPVEILSS
              LLIDADLR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRLAEFIQKCRGDYALIMIDSAPVMGLADAPLVSRLVDGVVFIVEANRSNFGQTKTALRRLRSVGANVLGVVLTKYRSAE
PRLAEFIQKCRGDYALIMIDSAPVMGLADAPLVSRLVDGVVFIVEANRSNFGQTKTALRRLRSVGANVLGVVLTKYRSAE
                IMIDSAP                                                         
       730       740
....:....|....:....|
AGLSYDYHYNYYSYGHGKKD
AGLSYDYHYNYYSYGHGKKD
    YDYHYNYYSY      

© 1998-2019