BYKdb

Annotate results for A0A0N7CIR2

A0A0N7CIR2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N7CIR2
DOMAINcd57/249TSSGISEGKSTVTANVAIAWAQEGKRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSN
EVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGVREVYDLVVLDVPPMLQ
VTDTQVLSSNLDGVILVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYG
YGYGYGYGYEDER
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDADLR
SITEWalker B167/173VVLDVPP
SITEY Cluster221/245YVMNDVYDADAGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFKHRYTESTDTMNNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
                                                        TSSGISEGKSTVTANVAIAWAQEG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
   LLIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
      VVLDVPP                                               YVMNDVYDADAGYGYGYGYG
         
....:....
YGYGYEDER
YGYGYEDER
YGYGY    
© 1998-2019