BYKdb

Annotate results for A0A0N7I8S6

A0A0N7I8S6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N7I8S6
DOMAINtad1/207MGPDFRFILRVLGSHKWLIAAIVVVLTGLSALGVSTLKDQYTSEALLLVDNRQVRVVREV
EQVVGAIPTEDAAILSEIEILKSPQVLNQVVNDLQLAQHPEFNPPAQEDETLPLVERAVA
YGRGLADRFWDGAPPAPVAWLLSHGDEVAQDIRAREAHAALGNDQIIARIHRKLDVAIVG
RSRVIQVRFTSKEPQLSRDVVDGIVRR
DOMAINcd549/737TSARPQDGKTSLTLAVAQVASQAGRRVVVVDTDFRRSRMEGLFDLSTKKGLSDWIAGDAT
LDEIVHTSDDVPFAMVPAGKLNPMTLDRFNVDSLVQLMAGLSPSFDLVVFDTAPALAVSD
ARIVCGAASKVLFVTRWGHTTASDLDAVADLGPIDHSKFVCVMTDVNLKKAASKGYQGPY
NSYVATRKY
SITEWalker A556/558GKT
SITEWalker A'576/583VVVDTDFR
SITEWalker B656/662VVFDTAP
SITEY Cluster724/738YQGPYNSYVATRKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGPDFRFILRVLGSHKWLIAAIVVVLTGLSALGVSTLKDQYTSEALLLVDNRQVRVVREVEQVVGAIPTEDAAILSEIEI
MGPDFRFILRVLGSHKWLIAAIVVVLTGLSALGVSTLKDQYTSEALLLVDNRQVRVVREVEQVVGAIPTEDAAILSEIEI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKSPQVLNQVVNDLQLAQHPEFNPPAQEDETLPLVERAVAYGRGLADRFWDGAPPAPVAWLLSHGDEVAQDIRAREAHAA
LKSPQVLNQVVNDLQLAQHPEFNPPAQEDETLPLVERAVAYGRGLADRFWDGAPPAPVAWLLSHGDEVAQDIRAREAHAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGNDQIIARIHRKLDVAIVGRSRVIQVRFTSKEPQLSRDVVDGIVRRYMETRQQMDRDLSTSAISWLQDRIVLLRREVAE
LGNDQIIARIHRKLDVAIVGRSRVIQVRFTSKEPQLSRDVVDGIVRR                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADSKVEEARVKGGLLKGGTGLMAQNELEQTRLRLSEASAIRARSVAQADTLERNLKAGNWNAIGGSIASPVVAQLRATVA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISTEMAQLSRQYGPKHPRIVELQGRLNEANSSLQQEIRREINGVREAAQVAVEQETALRSMITRMEGSYATMQEQAIPL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTLESEATAKRQLLDSLLGRLEEVEAQKDSRAFPAAVKLVSAPQVPHEPSGPFRILLLLAGFVAALALAIFSVFGLELLQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRIHTPDAVRRILGVGTVHIVPHHSDRGAKGRLYKIFQRHPFSLFSESLRALFRNHLSDLGPVGALAVTSARPQDGKTSL
                                                                    TSARPQDGKTSL
                                                                           GKT  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLAVAQVASQAGRRVVVVDTDFRRSRMEGLFDLSTKKGLSDWIAGDATLDEIVHTSDDVPFAMVPAGKLNPMTLDRFNVD
TLAVAQVASQAGRRVVVVDTDFRRSRMEGLFDLSTKKGLSDWIAGDATLDEIVHTSDDVPFAMVPAGKLNPMTLDRFNVD
               VVVDTDFR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLVQLMAGLSPSFDLVVFDTAPALAVSDARIVCGAASKVLFVTRWGHTTASDLDAVADLGPIDHSKFVCVMTDVNLKKAA
SLVQLMAGLSPSFDLVVFDTAPALAVSDARIVCGAASKVLFVTRWGHTTASDLDAVADLGPIDHSKFVCVMTDVNLKKAA
               VVFDTAP                                                          
       730       740       
....:....|....:....|....:..
SKGYQGPYNSYVATRKYYGDQTLRAAP
SKGYQGPYNSYVATRKY          
   YQGPYNSYVATRKYY         

© 1998-2019