BYKdb

Annotate results for A0A0N7KWH3

A0A0N7KWH3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N7KWH3
DOMAINtad12/249DEIDLGRLIGELIDHRKLIISITTLSTLIALIYAIFATPIFQADALVQIEQKQGNAILNS
LSQVLPDSQPQSAPEIALLQSRMILGKTVNDLNLQINVQRKYFPLIGRGYARLTGQSAGE
ITVGMLHLESQDQTETPDITLKVADSQKFIIEYNGNEVSGNVGELIKKAGLTIRVDSIDA
KEGSVFEINYVDQLKAIRNLGTSFKVTEQGKDTGILSLTLTGENPKLIATILNDISEN
DOMAINcd526/715SGASPNAGKTFVSTNLAATIASAGKKILFIDADLRKGYVHKMLGGEQVGYGLSDILSGQK
DVNSVIKNSREGGFDYIGRGQVPPNPAELLMHTNFKKFIEWASKNYELVIIDTPPILAVT
DAAIIGQYVGTVLLVARYEENTVKEITVSIRRFEQSGVAVKGCILNGVVKKASNYYGYGY
HDYGYTYKNN
SITEWalker A533/535GKT
SITEWalker A'553/560LFIDADLR
SITEWalker B634/640VIIDTPP
SITEY Cluster700/712YYGYGYHDYGYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQVNEKTKDNDEIDLGRLIGELIDHRKLIISITTLSTLIALIYAIFATPIFQADALVQIEQKQGNAILNSLSQVLPDSQ
           DEIDLGRLIGELIDHRKLIISITTLSTLIALIYAIFATPIFQADALVQIEQKQGNAILNSLSQVLPDSQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQSAPEIALLQSRMILGKTVNDLNLQINVQRKYFPLIGRGYARLTGQSAGEITVGMLHLESQDQTETPDITLKVADSQKF
PQSAPEIALLQSRMILGKTVNDLNLQINVQRKYFPLIGRGYARLTGQSAGEITVGMLHLESQDQTETPDITLKVADSQKF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIEYNGNEVSGNVGELIKKAGLTIRVDSIDAKEGSVFEINYVDQLKAIRNLGTSFKVTEQGKDTGILSLTLTGENPKLIA
IIEYNGNEVSGNVGELIKKAGLTIRVDSIDAKEGSVFEINYVDQLKAIRNLGTSFKVTEQGKDTGILSLTLTGENPKLIA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TILNDISENYLAQNIARQAAQDAKSLDFLNEQLPKVRTELDIAESKLNEYRKQKDSVDLSMEAKSVLDQIVNVDNQLNEL
TILNDISEN                                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFREAEISQLYTREHPTYKALMEKRKTLQDEKNRLNKKVSVMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAKSSA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGNVRIIDQAVTNPKPVKPQKIMIVLIGIVFGLFISMGLVLLRVFLRRGIESPEQLEEAGVSVYASVPVSEWLMKNIDKN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRKKNESTILLTAENPADMAVEAIRSLRTTLHFAMLEAKNNVLMISGASPNAGKTFVSTNLAATIASAGKKILFIDADLR
                                             SGASPNAGKTFVSTNLAATIASAGKKILFIDADLR
                                                    GKT                 LFIDADLR
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGYVHKMLGGEQVGYGLSDILSGQKDVNSVIKNSREGGFDYIGRGQVPPNPAELLMHTNFKKFIEWASKNYELVIIDTPP
KGYVHKMLGGEQVGYGLSDILSGQKDVNSVIKNSREGGFDYIGRGQVPPNPAELLMHTNFKKFIEWASKNYELVIIDTPP
                                                                         VIIDTPP
       650       660       670       680       690       700       710     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
ILAVTDAAIIGQYVGTVLLVARYEENTVKEITVSIRRFEQSGVAVKGCILNGVVKKASNYYGYGYHDYGYTYKNN
ILAVTDAAIIGQYVGTVLLVARYEENTVKEITVSIRRFEQSGVAVKGCILNGVVKKASNYYGYGYHDYGYTYKNN
                                                           YYGYGYHDYGYTY   

© 1998-2019