BYKdb

Annotate results for A0A0N7LZV6

A0A0N7LZV6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N7LZV6
DOMAINtad27/227DYIDIHRVLRGLRRRIWLLIFVAIAAAGAFAGIASLQEPQYESSATLMLDPREQRALGNQ
TQVVQHLKLTSPIVDSEVAVLRGQSLQMRALELVLGDPELARRYYAIDPALQPPGLVDRL
QSIASSALSQLFGSAATAGPEPIAEPRDESADLDGRKKRILGVLRKGLSVHRIGESYAIN
LRQETADPELSATFANALAAV
DOMAINcd565/749MSSLPDEGKTTTAMAMAYTYASFDKRTVLVDLDTRCAEAMPALTQGTGPDLSSWLEKGGD
PSACTYPSQQGDFWVIGNRNGAGNMVPPPSRDEIRALLTELSKNFDVIVVDAPPLLVLSD
GLAIAKEVDHILMNVRYRKTAKQSVATALALLEKVGERPTGLIMTMTDAKSEPQAYGYGY
SYGYS
SITEWalker A572/574GKT
SITEWalker A'592/599VLVDLDTR
SITEWalker B672/678IVVDAPP
SITE-582/-584YTY
SITEY Cluster740/748YGYGYSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNLTSKQLGSTTGYAPSSSGARDSVDYIDIHRVLRGLRRRIWLLIFVAIAAAGAFAGIASLQEPQYESSATLMLDPREQ
                          DYIDIHRVLRGLRRRIWLLIFVAIAAAGAFAGIASLQEPQYESSATLMLDPREQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RALGNQTQVVQHLKLTSPIVDSEVAVLRGQSLQMRALELVLGDPELARRYYAIDPALQPPGLVDRLQSIASSALSQLFGS
RALGNQTQVVQHLKLTSPIVDSEVAVLRGQSLQMRALELVLGDPELARRYYAIDPALQPPGLVDRLQSIASSALSQLFGS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AATAGPEPIAEPRDESADLDGRKKRILGVLRKGLSVHRIGESYAINLRQETADPELSATFANALAAVYIQEQVENRRKTM
AATAGPEPIAEPRDESADLDGRKKRILGVLRKGLSVHRIGESYAINLRQETADPELSATFANALAAV             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEVTGWLQVQVDASGRELERAEEAVRDFRVADSWNSKDVLRQQLDEMKVQIAETRADQVTKRAWLQTVASLADENEIMVI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQQQGSSLLQQLHNELEALLREDVRLSSSLSADHPDRRNLAVEMARLRANIDDAVLSYSAGLQSEVEVLHLREKDLEVEI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAMDHKLEQLELTDISFRQLERKADAARISYENLLARLGEARAQVTFERAEAKVIDPAEISLVPSSPKVKLMAAFGAALG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSATLIFIVLREFVSAGFTQANELENHFALPVLGSIPHVRMKKPFAVIAKMNMDRFSPLAERVRQISAILGQKNKSGDTL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMVVMSSLPDEGKTTTAMAMAYTYASFDKRTVLVDLDTRCAEAMPALTQGTGPDLSSWLEKGGDPSACTYPSQQGDFWVI
    MSSLPDEGKTTTAMAMAYTYASFDKRTVLVDLDTRCAEAMPALTQGTGPDLSSWLEKGGDPSACTYPSQQGDFWVI
           GKT                 VLVDLDTR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNRNGAGNMVPPPSRDEIRALLTELSKNFDVIVVDAPPLLVLSDGLAIAKEVDHILMNVRYRKTAKQSVATALALLEKVG
GNRNGAGNMVPPPSRDEIRALLTELSKNFDVIVVDAPPLLVLSDGLAIAKEVDHILMNVRYRKTAKQSVATALALLEKVG
                               IVVDAPP                                          
       730       740         
....:....|....:....|....:....
ERPTGLIMTMTDAKSEPQAYGYGYSYGYS
ERPTGLIMTMTDAKSEPQAYGYGYSYGYS
                   YGYGYSYGY 

© 1998-2019