BYKdb

Annotate results for A0A0N7Z5K9

A0A0N7Z5K9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N7Z5K9
DOMAINtad18/169PDPGYGQLFGVLMRRKIWFLGAVAGTIALAAAVTAFMPPTYRSTMQMLVESNYRERRAPG
DNSPSFADPNVESDTATQVNLMRSTQLLQRAVDELQPRYSDIDVDRLRNRLNIAQVQELR
GSERVNTSIVEMSYIDYDRVKTREVLKSLQRV
DOMAINcd554/737TSALAGEGKSTVALGLAISAARLHQRVLLIDADLRRPGLHEQLQLPNEHGLSTLLTSDRA
LTQAAIQPASTYSDLPISVLTAGPTPTDSVKLLSSKRMRDLMTVFEQHYDLVILDCPPVL
GIVDALLAASFCDGTLLVGRMGHVDKNEVSQAVGMLSRLNLVGVVANCSESGHSYYYRSA
TQTA
SITEWalker A561/563GKS
SITEWalker A'581/588LLIDADLR
SITEWalker B665/671VILDCPP
SITEY Cluster728/730YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAQGNITLFNPSPPAQEPDPGYGQLFGVLMRRKIWFLGAVAGTIALAAAVTAFMPPTYRSTMQMLVESNYRERRAPGDNS
                 PDPGYGQLFGVLMRRKIWFLGAVAGTIALAAAVTAFMPPTYRSTMQMLVESNYRERRAPGDNS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSFADPNVESDTATQVNLMRSTQLLQRAVDELQPRYSDIDVDRLRNRLNIAQVQELRGSERVNTSIVEMSYIDYDRVKTR
PSFADPNVESDTATQVNLMRSTQLLQRAVDELQPRYSDIDVDRLRNRLNIAQVQELRGSERVNTSIVEMSYIDYDRVKTR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQIPQVQEKVNKAEADLERFRKSSNLVDPEDQSRALIESLRELQKDQQSN
EVLKSLQRV                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGELASAQARFLALQQQLARSPEQATIASRLSQSNQYQALLAEIQKTEVALAQQQTRFTSKTPFVQQLLDQRQRQVALLQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEAQRVLGADAGAIAGSDSALFSTGQLGENDLKFASDLTQAQVDFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTVKLQRDTLDQLEKARQGLGLEIARGGFDWQIVEQAKVGRQVGPNWLRNLLIGGAAGLMLGSVAAFLRESADKSIRTSE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLTKQASIPLIGMVPELPMSELMPTTNFAFGRSTGDTSMLQVLHWAPFRESLDLIYKNLQLMTDGDPMRSLVVTSALAGE
                                                                         TSALAGE

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSTVALGLAISAARLHQRVLLIDADLRRPGLHEQLQLPNEHGLSTLLTSDRALTQAAIQPASTYSDLPISVLTAGPTPT
GKSTVALGLAISAARLHQRVLLIDADLRRPGLHEQLQLPNEHGLSTLLTSDRALTQAAIQPASTYSDLPISVLTAGPTPT
GKS                 LLIDADLR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSVKLLSSKRMRDLMTVFEQHYDLVILDCPPVLGIVDALLAASFCDGTLLVGRMGHVDKNEVSQAVGMLSRLNLVGVVAN
DSVKLLSSKRMRDLMTVFEQHYDLVILDCPPVLGIVDALLAASFCDGTLLVGRMGHVDKNEVSQAVGMLSRLNLVGVVAN
                        VILDCPP                                                 
       730       
....:....|....:..
CSESGHSYYYRSATQTA
CSESGHSYYYRSATQTA
       YYY       

© 1998-2019