BYKdb

Annotate results for A0A0N8SQG2

A0A0N8SQG2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N8SQG2
DOMAINtad1/231MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALL
GKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLE
VPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFS
VSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHL
DOMAINcd507/695SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAP
SITEWalker A514/516GKS
SITEWalker A'534/541LLIDADMR
SITEWalker B614/620ILIDTPP
SITEY Cluster682/691YDYAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHL         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRMTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIESLRSLRTSLHFAMLAARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
                          SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
                                 GKS                 LLIDADMR                   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
                                                     ILIDTPP                    
       650       660       670       680       690      
....:....|....:....|....:....|....:....|....:....|....:.
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAP 
                                         YDYAAYGYNY     
© 1998-2019