BYKdb

Annotate results for A0A0N8VAR8

A0A0N8VAR8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N8VAR8
DOMAINtad10/197EVIDIRQYFNVLLNYKWRILLFSIMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIE
EVYGLDTKSQEYYLTQIEILKSDTIAQEVIDRLDLASDPEFDLNPESEQSPSLKERLLEW
MPFLQGFKQQEVVIDPELEAYRGNRLILYKFKRGMEISPIRKTQLVNIYYTAGDPKLAAK
IANEIARV
DOMAINcd543/732TSCLPGEGKTTSSINLALSLAQMEKTLLIDCDLRKPAIAHRFAISGSQPGVTNLLTGTQS
FEDCVYHDEQSGLDVLTAGVYSSNPLELLSSTKFSELLADLRGQYQRIVIDTPPCLAVSD
SFMLAQHVDSVILVIDANHTRTQVVREVVGKLTQQGSRIDGVVLNRLNAKKASRYSGYYH
YQAYYGEDHK
SITEWalker A550/552GKT
SITEWalker A'569/576LLIDCDLR
SITEWalker B650/656IVIDTPP
SITEY Cluster717/727YSGYYHYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSIMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
         EVIDIRQYFNVLLNYKWRILLFSIMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YYLTQIEILKSDTIAQEVIDRLDLASDPEFDLNPESEQSPSLKERLLEWMPFLQGFKQQEVVIDPELEAYRGNRLILYKF
YYLTQIEILKSDTIAQEVIDRLDLASDPEFDLNPESEQSPSLKERLLEWMPFLQGFKQQEVVIDPELEAYRGNRLILYKF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARV                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEGLVDVQGVEGLASQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSEFSKRYGPKHPKLKSATAQLDAVRKNLRSELKQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLVPSKPNKKLIVMLAFVVSFGFACVVAFIADAMSDTFADIK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVEKQLALSLLGVVPAVRKRNGKLDAKAYFDTELRELTEAVRTIRTSYLLAHVNQEQHVVMLTSCLPGEGKTTSSINLAL
                                                              TSCLPGEGKTTSSINLAL
                                                                     GKT        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLAQMEKTLLIDCDLRKPAIAHRFAISGSQPGVTNLLTGTQSFEDCVYHDEQSGLDVLTAGVYSSNPLELLSSTKFSELL
SLAQMEKTLLIDCDLRKPAIAHRFAISGSQPGVTNLLTGTQSFEDCVYHDEQSGLDVLTAGVYSSNPLELLSSTKFSELL
        LLIDCDLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRGQYQRIVIDTPPCLAVSDSFMLAQHVDSVILVIDANHTRTQVVREVVGKLTQQGSRIDGVVLNRLNAKKASRYSGY
ADLRGQYQRIVIDTPPCLAVSDSFMLAQHVDSVILVIDANHTRTQVVREVVGKLTQQGSRIDGVVLNRLNAKKASRYSGY
         IVIDTPP                                                            YSGY
       730       
....:....|....:..
YHYQAYYGEDHKSSATQ
YHYQAYYGEDHK     
YHYQAYY          

© 1998-2019