BYKdb

Annotate results for A0A0N9W1V6

A0A0N9W1V6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0N9W1V6
DOMAINcd74/249TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDNEA
ELQEVLVNPTLPRFVVLPTREPIPLSTEVLSSPTVSDLITDLRERYDSRIVIFDLPPLLS
SDDAITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNKAERPSRSYY
SITEWalker A81/83GKT
SITEWalker A'102/109LLVDFDLR
SITEWalker B184/190VIFDLPP
SITEY Cluster248/249YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTMPKAMTVTGQSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENGWRTLAITSPTPEA
                                                                         TSPTPEA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDNEAELQEVLVNPTLPRFVVLPTREPIPLST
GKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDNEAELQEVLVNPTLPRFVVLPTREPIPLST
GKT                  LLVDFDLR                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVLSSPTVSDLITDLRERYDSRIVIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNK
EVLSSPTVSDLITDLRERYDSRIVIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNK
                       VIFDLPP                                                  
         
....:....
AERPSRSYY
AERPSRSYY
       YY
© 1998-2019