BYKdb

Annotate results for A0A0N9WBG0

A0A0N9WBG0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0N9WBG0
DOMAINtad9/262DHIDLKELFFSIIAHWLLILICIVLSLFIALMYLRVTPNIYSVNALVQVEEKKGTSAALL
GDLSNIVDQKQPAQTEIEILKSRLVLGDVIRHLNLDIAITGDKTSLLDRLIHKNQYITEY
HAQSIIFNDDKKSFRIQKFIIPEKYLDHPLEIHFKDNVFSLYDTETETKLIQLPLNQDHI
TRTVDGEWHLSIYTSDHHNSSYFITKKSFPRAINDILGHFSVAEKGKLTGILNLQYRGEN
REHITKVLNSILSA
DOMAINcd540/724TGPAPEVGKSFTSTNLAVILAQGKKRVLIIDADMRRGNLDQYFNMINQPGLAEYLNNQLE
LGCVTRKTNIENLDLITRGKSPHNPSELLNSNNFKKLLDHFATQYDYILIDTPPILAVTD
GLIISQYVGMSILVARFAKTQIKELEIVINRFKQVDSQVTGIILNDIQKSTLGYNYSYTY
HYENR
SITEWalker A547/549GKS
SITEWalker A'567/574LIIDADMR
SITEWalker B647/653ILIDTPP
SITE-644/-646YDY
SITE-618/-620GKS
SITEY Cluster713/721YNYSYTYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTKQNIEDHIDLKELFFSIIAHWLLILICIVLSLFIALMYLRVTPNIYSVNALVQVEEKKGTSAALLGDLSNIVDQKQP
        DHIDLKELFFSIIAHWLLILICIVLSLFIALMYLRVTPNIYSVNALVQVEEKKGTSAALLGDLSNIVDQKQP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQTEIEILKSRLVLGDVIRHLNLDIAITGDKTSLLDRLIHKNQYITEYHAQSIIFNDDKKSFRIQKFIIPEKYLDHPLEI
AQTEIEILKSRLVLGDVIRHLNLDIAITGDKTSLLDRLIHKNQYITEYHAQSIIFNDDKKSFRIQKFIIPEKYLDHPLEI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFKDNVFSLYDTETETKLIQLPLNQDHITRTVDGEWHLSIYTSDHHNSSYFITKKSFPRAINDILGHFSVAEKGKLTGIL
HFKDNVFSLYDTETETKLIQLPLNQDHITRTVDGEWHLSIYTSDHHNSSYFITKKSFPRAINDILGHFSVAEKGKLTGIL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLQYRGENREHITKVLNSILSAYNKQNIDRRTAETAQTLKFLDEKLPILLNELMVAERQFNEFREKNNTIDITKESELYL
NLQYRGENREHITKVLNSILSA                                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQSMQLDTQRAKLLQQVAEASSKYTDAHPVMQQMNAQLTALNQKIAELDGVLKKLPDLQHQYLQLFREVEVKQQLYTSLL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSSQQLAIAKAGEIGNVRIIDTAIDPITPIKPSKLTIIVLSIFIGGFIGIMIAILRNFLRNGIKDAQQIENTFDIPVYAT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPRSKTQLNWVKLRKHKKNQVIPILAVQNSTDIAIESLRSMRTALHVASKTAKNNIIMITGPAPEVGKSFTSTNLAVILA
                                                           TGPAPEVGKSFTSTNLAVILA
                                                                  GKS           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGKKRVLIIDADMRRGNLDQYFNMINQPGLAEYLNNQLELGCVTRKTNIENLDLITRGKSPHNPSELLNSNNFKKLLDHF
QGKKRVLIIDADMRRGNLDQYFNMINQPGLAEYLNNQLELGCVTRKTNIENLDLITRGKSPHNPSELLNSNNFKKLLDHF
      LIIDADMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQYDYILIDTPPILAVTDGLIISQYVGMSILVARFAKTQIKELEIVINRFKQVDSQVTGIILNDIQKSTLGYNYSYTYH
ATQYDYILIDTPPILAVTDGLIISQYVGMSILVARFAKTQIKELEIVINRFKQVDSQVTGIILNDIQKSTLGYNYSYTYH
      ILIDTPP                                                           YNYSYTYH
    
....
YENR
YENR
Y   

© 1998-2019