BYKdb

Annotate results for A0A0P0CSF9

A0A0P0CSF9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0CSF9
DOMAINtad28/265TSIDFVTLLHVAKRSIPWIILLVLLGIGGSYLYLRYTKKVYESSSTIKLDEQSQAGVLGL
QNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTMPLQVSYFVEARVLDAELYKDSPFQVS
YDNESFNLYDQKIYVKFTSPSRFDLYVGENGNQSSYTVGNPITVSGSTFSINPVNNFSSS
NVGIVYYFIVNSDQRLKGYIDTNLTTAILNPESKTIQIAFKDFNRFKARDIVNNIDTV
DOMAINcd604/792TSTISGEGKTFVAVNLGGIIAMSGLKVVILDLDMRKPKVHIALDGDNSKGMSTVLIDKHS
LAECLQQTSVPDLDFISAGPTPPNPSELIMGSRFDNVLEELHQMYDVVLIDSPPVGLVTD
GVLIMRKADVPLYIVRAGYSKKAFLKGIDKLVRTNHLSNMATILNDVSSMNMYGYGYGYG
YGYGYGYGQ
SITEWalker A611/613GKT
SITEWalker A'631/638VILDLDMR
SITEWalker B711/717VLIDSPP
SITE-736/-742YIVRAGY
SITEY Cluster776/795YGYGYGYGYGYGYGYGQGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVKTVNDLDELDHRLGSGEDEDDDGGTSIDFVTLLHVAKRSIPWIILLVLLGIGGSYLYLRYTKKVYESSSTIKLDEQS
                           TSIDFVTLLHVAKRSIPWIILLVLLGIGGSYLYLRYTKKVYESSSTIKLDEQS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAGVLGLQNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTMPLQVSYFVEARVLDAELYKDSPFQVSYDNESFNLYDQKI
QAGVLGLQNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTMPLQVSYFVEARVLDAELYKDSPFQVSYDNESFNLYDQKI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVKFTSPSRFDLYVGENGNQSSYTVGNPITVSGSTFSINPVNNFSSSNVGIVYYFIVNSDQRLKGYIDTNLTTAILNPES
YVKFTSPSRFDLYVGENGNQSSYTVGNPITVSGSTFSINPVNNFSSSNVGIVYYFIVNSDQRLKGYIDTNLTTAILNPES

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTIQIAFKDFNRFKARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIERFVRQNMSYDLKANFQ
KTIQIAFKDFNRFKARDIVNNIDTV                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALAQVQELEKEKLELRFQLSLLNTIQTKVQRNEDLGMIASSIQGQENQDPQLAEQLTELSDLQAQQRTRRLTSRGNTLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNSLEERLEIAQNRLRDVINGSKGLVQTKINNIDRNQSELTGKILQAPSKETERARLERIFGLYESFFTQILNRRVEYGI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMAGTTADFQILSPASLPSESAPISPNPFIIYAIGIAGGLFLGVGLIATRYLMHDTVANVRELERNTSVPVLGVVPSYDK


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKMPFSKLVVNQNPKSALSESIRSIRTNLEFMSASKKKRIISVTSTISGEGKTFVAVNLGGIIAMSGLKVVILDLDMRKP
                                           TSTISGEGKTFVAVNLGGIIAMSGLKVVILDLDMRKP
                                                  GKT                 VILDLDMR  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVHIALDGDNSKGMSTVLIDKHSLAECLQQTSVPDLDFISAGPTPPNPSELIMGSRFDNVLEELHQMYDVVLIDSPPVGL
KVHIALDGDNSKGMSTVLIDKHSLAECLQQTSVPDLDFISAGPTPPNPSELIMGSRFDNVLEELHQMYDVVLIDSPPVGL
                                                                      VLIDSPP   
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTDGVLIMRKADVPLYIVRAGYSKKAFLKGIDKLVRTNHLSNMATILNDVSSMNMYGYGYGYGYGYGYGYGQGYYDEEVK
VTDGVLIMRKADVPLYIVRAGYSKKAFLKGIDKLVRTNHLSNMATILNDVSSMNMYGYGYGYGYGYGYGYGQ        
                                                       YGYGYGYGYGYGYGYGQGYY     
       810  
....:....|..
PTVGSKLKSIFK


© 1998-2019