BYKdb

Annotate results for A0A0P0DCC6

A0A0P0DCC6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0DCC6
DOMAINtad31/198GALIFARIWAAVWSRRTLALGIIMSALLLGLVATFLATPQYSSETRIEILPDAPVATSVE
GQREKALLNELSFYNTQYSLLKSESLAERVARAGNLAADKDFLEAYKLEGADASLGSGER
QKLSKSIAAILLKNVNVTPVRNSSLVDVSFSTPSAKLSAKLANLWAQQ
DOMAINcd534/723TSSQPREGKSNSSLSLATVLAATGKSVILIDADIRNPSQDHYLSLPNQLGLTHYLAGDDN
LDAMIVELPDKGFSVITAGKVPPNAAELLGSERLDQLVELLSARFDHVLIDTAPLLGLAD
APIVARCVEGVLFVIEANSTKGRAISLALSRLRMSGAKLFGAVVTKVGLRNQAYGYGYGY
GYGYGYGATS
SITE-557/-559GKS
SITEWalker A'561/568ILIDADIR
SITEWalker B641/647VLIDTAP
SITEY Cluster707/719YGYGYGYGYGYGY
SITEWalker A541/543GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQNEASEALAWEADLAGQRKIGAKDFQETGALIFARIWAAVWSRRTLALGIIMSALLLGLVATFLATPQYSSETRIEIL
                              GALIFARIWAAVWSRRTLALGIIMSALLLGLVATFLATPQYSSETRIEIL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDAPVATSVEGQREKALLNELSFYNTQYSLLKSESLAERVARAGNLAADKDFLEAYKLEGADASLGSGERQKLSKSIAAI
PDAPVATSVEGQREKALLNELSFYNTQYSLLKSESLAERVARAGNLAADKDFLEAYKLEGADASLGSGERQKLSKSIAAI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLKNVNVTPVRNSSLVDVSFSTPSAKLSAKLANLWAQQFLQATIDRRFSATSDARRYLEQRLEALRQGLEASERALINYG
LLKNVNVTPVRNSSLVDVSFSTPSAKLSAKLANLWAQQ                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSKGIVTIAAQTDANGRTQARTLVGADIEAISSALSKAKELRVAAQAELANTMTGSAAINAPSIANLRQKRAELEAELAQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRTIFAEDYPRIVSLRTQLASLDRSIVAETARSTQSNREAFNAASRREDELRAELEKLTGQYNQQQRESIEMAILQREVD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNRQLYEGLLQRYKEIGVSGVGTNNISIVDRAMVSSSPSSPILLLNLALALFIGLMAAAATIFVLEKIDSSVRDPQEVAD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFGLPLLGAIPESSQPVAEAISDKKSAIYEAYFSAMTNLGFLTTHGAPRTLMLTSSQPREGKSNSSLSLATVLAATGKSV
                                                     TSSQPREGKSNSSLSLATVLAATGKSV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILIDADIRNPSQDHYLSLPNQLGLTHYLAGDDNLDAMIVELPDKGFSVITAGKVPPNAAELLGSERLDQLVELLSARFDH
ILIDADIRNPSQDHYLSLPNQLGLTHYLAGDDNLDAMIVELPDKGFSVITAGKVPPNAAELLGSERLDQLVELLSARFDH
ILIDADIR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIDTAPLLGLADAPIVARCVEGVLFVIEANSTKGRAISLALSRLRMSGAKLFGAVVTKVGLRNQAYGYGYGYGYGYGYG
VLIDTAPLLGLADAPIVARCVEGVLFVIEANSTKGRAISLALSRLRMSGAKLFGAVVTKVGLRNQAYGYGYGYGYGYGYG
VLIDTAP                                                           YGYGYGYGYGYGY 
      
....:.
ATSEAK
ATS   

© 1998-2019