BYKdb

Annotate results for A0A0P0DHN7

A0A0P0DHN7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0DHN7
DOMAINtad1/139MDVNQYLRIFRAHWLGIILLTLAGVVLAYGWTMFQPRVYTADSTAIIQARTAASGDNSLG
EQSLANIVAQGKVKTYVDVGTSRRVAERTISDLGLDTTPEALVGSVIVTNPLETVSLRVS
ATANTPEGARDLAESWVRS
DOMAINcd281/471TSPLPGDGKSTTASNLAITLAANGQRTILIDGDLRRPMISTVFGLVEGAGLTDVLAGRAE
LADVAQTIGRNRNLVVVGAGKIPPNPSEVLGSERMRELLAALSEQATVIVDAPPLIPVTD
AAVVANRADGAIVVTTVGKTTFEVLGKALSNLERASARPLGIVLNRVPRKGSGAAYYGYQ
YHGEYYRSNDE
SITE-418/-420GKT
SITEWalker A'308/315ILIDGDLR
SITEWalker B388/394VIVDAPP
SITEY Cluster456/466YYGYQYHGEYY
SITEWalker A288/290GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDVNQYLRIFRAHWLGIILLTLAGVVLAYGWTMFQPRVYTADSTAIIQARTAASGDNSLGEQSLANIVAQGKVKTYVDVG
MDVNQYLRIFRAHWLGIILLTLAGVVLAYGWTMFQPRVYTADSTAIIQARTAASGDNSLGEQSLANIVAQGKVKTYVDVG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSRRVAERTISDLGLDTTPEALVGSVIVTNPLETVSLRVSATANTPEGARDLAESWVRSMAAEVNVLETKDPEVQGATFL
TSRRVAERTISDLGLDTTPEALVGSVIVTNPLETVSLRVSATANTPEGARDLAESWVRS                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAMDSARLPTAPSSPNVRLALAIGGLLGLVAGIAYGILRYTLDRRIRSVDGVEKATGVAVVGTIPEEKSFTTDDRLIPFD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGNSVKSRNAHLFGIAEAMRELRTNIQFMDVDNPPKVMVVTSPLPGDGKSTTASNLAITLAANGQRTILIDGDLRRPMIS
                                        TSPLPGDGKSTTASNLAITLAANGQRTILIDGDLRRPMIS
                                               GKS                 ILIDGDLR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVFGLVEGAGLTDVLAGRAELADVAQTIGRNRNLVVVGAGKIPPNPSEVLGSERMRELLAALSEQATVIVDAPPLIPVTD
TVFGLVEGAGLTDVLAGRAELADVAQTIGRNRNLVVVGAGKIPPNPSEVLGSERMRELLAALSEQATVIVDAPPLIPVTD
                                                                   VIVDAPP      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVVANRADGAIVVTTVGKTTFEVLGKALSNLERASARPLGIVLNRVPRKGSGAAYYGYQYHGEYYRSNDETQPADDAAP
AAVVANRADGAIVVTTVGKTTFEVLGKALSNLERASARPLGIVLNRVPRKGSGAAYYGYQYHGEYYRSNDE         
                                                       YYGYQYHGEYY              
       490       500  
....:....|....:....|..
LRRTPFESAPAPRAESRRAARR


© 1998-2019