BYKdb

Annotate results for A0A0P0F4J6

A0A0P0F4J6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0F4J6
DOMAINtad40/244QEATVFATLAVLWRRKLLLLTVILLGTATITYVMQSLKPMYRATAMVQLDSRRVELAEFK
SVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPTLKAPDGADDHWLKRVT
KAGVGALPPEGNDVLRRIVQQATALFRADDGPVARDPDQARLLTIDTLLRRIEARNDDRS
FTIIIEASSVDPAKAAAIANAFGQA
DOMAINcd592/778TSSIPKEGKSVLAANLARSLAGLGLNTLLIDADFRRPSIAKLLGYQPQGSVADLLDGRVG
IDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVVIDSAPVMLFSDA
LALSFLADSVIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDA
YYYALHA
SITEWalker A599/601GKS
SITEWalker A'619/626LLIDADFR
SITEWalker B698/704VVIDSAP
SITEY Cluster772/774YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSSIGKGGTLPGHEAHASVLPDSLLQSGAGESSDVRSRQEATVFATLAVLWRRKLLLLTVILLGTATITYVMQSLKPMY
                                       QEATVFATLAVLWRRKLLLLTVILLGTATITYVMQSLKPMY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPTLKAPDGADDHWLKRVTK
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPTLKAPDGADDHWLKRVTK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGVGALPPEGNDVLRRIVQQATALFRADDGPVARDPDQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA
AGVGALPPEGNDVLRRIVQQATALFRADDGPVARDPDQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGQAYLDYRTEMNRDLTERVNQWLGGRLIEAREAVRGAEEAIRNFRKENSLLELPPDGRNMVQQQMNEIATQLTAAQAQK
FGQA                                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAEARVRQARDQTATNNAAAIPEVLASPLIQKLREAEAMLERRLAELQQVYGDKHQEIVNLRRGIGELKARIRDEVGKI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAERYEQTMALKNTGALDAHLSAPA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPPIRPAFPQLRMSLGVGLVGSTALAVALVLLLERLSSGLRTPSQVERATGVPCLGMVPSLPRNEATWNLPLHPDSRRAR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIGAFREAIQTVRTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGLGLNTLLIDADFRRPSIAKLLGYQPQG
                               TSSIPKEGKSVLAANLARSLAGLGLNTLLIDADFRRPSIAKLLGYQPQG
                                      GKS                 LLIDADFR              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVVIDSAPVMLFSDALALSFLADS
SVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVVIDSAPVMLFSDALALSFLADS
                                                         VVIDSAP                
       730       740       750       760       770       780  
....:....|....:....|....:....|....:....|....:....|....:....|..
VIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDAYYYALHAPARH
VIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDAYYYALHA    
                                                   YYY        

© 1998-2019