BYKdb

Annotate results for A0A0P0NBB9

A0A0P0NBB9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P0NBB9
DOMAINcd41/230TSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMSGIFKTRDKITGLTDYLAGAT
DLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGN
YGNYGNYGKK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155IVVDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGSYGNYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
                                        TSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
                                                                    IVVDTPP     
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKKK
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKK 
                                                      YGSYGNYGNYGNY    
© 1998-2019