BYKdb

Annotate results for A0A0P0R9G7

A0A0P0R9G7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0R9G7
DOMAINtad20/271EGGYVGKLLDTLYEGRKTIVIIAALFTLVGLVYAMLARPVYQADMLIHVEDSDGAAKNAL
ADVSSMFAVKTAASAEIEVLRSRMVVSRAVEATQLYINASPRYFPVVGRWIATHLSVSSW
SGRGGYAWGDEAITVARFDVPDRMHGARFIVTVKGNGAYTLEHNGMDLPGRVGETLHAEV
PGGAIDLLVSAIDGHPGVTFELSRSSALAATLGLQSRLMISEKGKESSVIGAALEGDDPV
KTSVILNAIGNE
DOMAINcd549/736AGPTPMVGKSFVSVNLAALLGASGQRVLLIDTDLRRGTLNASVGVRSSPGITDIMQGMHY
ESAVHRQIMPGVDFVANGGYVANASELLRHSRFKRFVEWADREYDVVLMDAPPILPVADS
GIVANLAGMVFLVARQGVTSVSELRESVRRFEQIGVPVRGVVFNDMTSRPGKYGSEYATY
GYASYSNA
SITEWalker A556/558GKS
SITEWalker A'576/583LLIDTDLR
SITEWalker B655/661VLMDAPP
SITEY Cluster721/733YGSEYATYGYASY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQREYLLEGSVDEGVLPPEGGYVGKLLDTLYEGRKTIVIIAALFTLVGLVYAMLARPVYQADMLIHVEDSDGAAKNALA
                   EGGYVGKLLDTLYEGRKTIVIIAALFTLVGLVYAMLARPVYQADMLIHVEDSDGAAKNALA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVSSMFAVKTAASAEIEVLRSRMVVSRAVEATQLYINASPRYFPVVGRWIATHLSVSSWSGRGGYAWGDEAITVARFDVP
DVSSMFAVKTAASAEIEVLRSRMVVSRAVEATQLYINASPRYFPVVGRWIATHLSVSSWSGRGGYAWGDEAITVARFDVP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRMHGARFIVTVKGNGAYTLEHNGMDLPGRVGETLHAEVPGGAIDLLVSAIDGHPGVTFELSRSSALAATLGLQSRLMIS
DRMHGARFIVTVKGNGAYTLEHNGMDLPGRVGETLHAEVPGGAIDLLVSAIDGHPGVTFELSRSSALAATLGLQSRLMIS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGKESSVIGAALEGDDPVKTSVILNAIGNEYMRQKVQRTQEEAEKSIAFLNQQLPELKATLERAEEEYNQFRSEHGAVD
EKGKESSVIGAALEGDDPVKTSVILNAIGNE                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGAEAAALLQSSAQAQNRIAELRQQRAQLDARYMPDNPALIAMNGQLEEAEKAMAELAVQTKRLPPLEQSVLRLQREVQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTNIYTNLLNTKEQLRLAKAGKVSNARLIDSAAVPEGPIRPKRALIVVAGSLTGLFVGAALVLFKRRMNSGIAMVDEIEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGLHVYASVPRSRVQQTLTRRLPDGVPGTCSVLACTASFDAAVESLRSFRGALEFALRDAPNHVVLLAGPTPMVGKSFV
                                                                    AGPTPMVGKSFV
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVNLAALLGASGQRVLLIDTDLRRGTLNASVGVRSSPGITDIMQGMHYESAVHRQIMPGVDFVANGGYVANASELLRHSR
SVNLAALLGASGQRVLLIDTDLRRGTLNASVGVRSSPGITDIMQGMHYESAVHRQIMPGVDFVANGGYVANASELLRHSR
               LLIDTDLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FKRFVEWADREYDVVLMDAPPILPVADSGIVANLAGMVFLVARQGVTSVSELRESVRRFEQIGVPVRGVVFNDMTSRPGK
FKRFVEWADREYDVVLMDAPPILPVADSGIVANLAGMVFLVARQGVTSVSELRESVRRFEQIGVPVRGVVFNDMTSRPGK
              VLMDAPP                                                           
       730       740    
....:....|....:....|....
YGSEYATYGYASYSNAGGDAGNAN
YGSEYATYGYASYSNA        
YGSEYATYGYASY           

© 1998-2019