BYKdb

Annotate results for A0A0P0YPX3

A0A0P0YPX3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0YPX3
DOMAINtad16/252DEIDLRRLLGTLIAHRWLIIGITALFSVAGIIYSLLATPIYQADAMVQVEQNVGNLLVND
LSQILPNSQPGSSTEIELIKSRMVTGKTVDDLNLETVVQQKYSSIFGRGWARLTGTEPAK
IALSRLNVPANSGDVELELTVIDAQQYVLSNNGTEIIKGKVGALESGHGISLLVSEISAE
PGTVFEIAKLPRLVAINNLLDALTVEDKGKDTGVLALSLVGDDPVLVRNILNSISKN
DOMAINcd533/713SGPSPSIGKTLVSINLAAVIAQAGRRILVVDADMRKGHAHSLLNCELGLGLSDVLSGQAS
PQQAIKQTSIENLSFISRGKIPSNPSELLMHNRLTEFLEWAGKEYDIVLVDTPPILAVTD
AVIVARNVGTTLLVARYGVNSLKEIEVSIRHFEQNGIEIQGIILNAVENKSGNVYYAYEY
K
SITEWalker A540/542GKT
SITEWalker A'560/567LVVDADMR
SITEWalker B640/646VLVDTPP
SITEY Cluster707/712YYAYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDNTKLGLSTANNHDEIDLRRLLGTLIAHRWLIIGITALFSVAGIIYSLLATPIYQADAMVQVEQNVGNLLVNDLSQIL
               DEIDLRRLLGTLIAHRWLIIGITALFSVAGIIYSLLATPIYQADAMVQVEQNVGNLLVNDLSQIL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNSQPGSSTEIELIKSRMVTGKTVDDLNLETVVQQKYSSIFGRGWARLTGTEPAKIALSRLNVPANSGDVELELTVIDAQ
PNSQPGSSTEIELIKSRMVTGKTVDDLNLETVVQQKYSSIFGRGWARLTGTEPAKIALSRLNVPANSGDVELELTVIDAQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYVLSNNGTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAKLPRLVAINNLLDALTVEDKGKDTGVLALSLVGDDPV
QYVLSNNGTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAKLPRLVAINNLLDALTVEDKGKDTGVLALSLVGDDPV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVRNILNSISKNYLLQNVERKSEEAAKSLDFLKDQLPEVRSFLDSAEDKLNRFRQANDSVDLSLEAKSVLDTVVGVEAQL
LVRNILNSISKN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTLKEAEISKLYTKEHPAYRALMEKRATLQQEKDKLNKRVSVMPKTQQVILRLTRDVQAAQEIYMQLLNKQQKLGITK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASTVGNVRIVDPAITQPRPVKPQKTIIVLIATLLGGLFSTGFVLLKTMLHRGIESPEQLEQLGINVYACIPLSELQHKSD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RETMLSGKRSSNRSSTLLAVGNLSDLAIEAVRSLRTRLHFALLEAKNNVLMISGPSPSIGKTLVSINLAAVIAQAGRRIL
                                                    SGPSPSIGKTLVSINLAAVIAQAGRRIL
                                                           GKT                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDADMRKGHAHSLLNCELGLGLSDVLSGQASPQQAIKQTSIENLSFISRGKIPSNPSELLMHNRLTEFLEWAGKEYDIV
VVDADMRKGHAHSLLNCELGLGLSDVLSGQASPQQAIKQTSIENLSFISRGKIPSNPSELLMHNRLTEFLEWAGKEYDIV
VVDADMR                                                                        V
       650       660       670       680       690       700       710   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
LVDTPPILAVTDAVIVARNVGTTLLVARYGVNSLKEIEVSIRHFEQNGIEIQGIILNAVENKSGNVYYAYEYK
LVDTPPILAVTDAVIVARNVGTTLLVARYGVNSLKEIEVSIRHFEQNGIEIQGIILNAVENKSGNVYYAYEYK
LVDTPP                                                            YYAYEY 

© 1998-2019