BYKdb

Annotate results for A0A0P0YR07

A0A0P0YR07 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P0YR07
DOMAINtad15/251DDVDLARLVGEIIDHRKLIISVTAIFTFIALLYVLFATPIYQADSLVQIEQKQGNSLINS
LNQALTDSQPQSAPELALLQSRMILGKTVDDLNLQIIAKQDYFPIIGRGWARLTGQENNS
VLISQFDAPSTLDSEAEVTMTVISANEYVIDHDGNIVKGKVGVLLKNNDLTFMVTKIDAE
PNSKFIVTKKTKLEAINNLQKFFSVADQGKDTGILNLTIQGDNPALLRKILDSISQN
DOMAINcd534/725SGATPDAGKTFISSNLSAIIAQTGKKILFIDADMRKGYVHKLLLTGQDNCKGLSEVLSSN
ENFEKVVHNINFANFDFIARGQIPPNPAELLMHKRFEELMTWAMENYDLIIIDTPPILAV
TDAAVIGRYAGTSLLVARFEENTPKEIYFAVKRFEQNGVTVKGCILNGVVKKASSYYGYG
YNSYGYTYKDDK
SITEWalker A541/543GKT
SITEWalker A'561/568LFIDADMR
SITEWalker B643/649IIIDTPP
SITEY Cluster709/721YYGYGYNSYGYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSPVMQTKAKNAESDDVDLARLVGEIIDHRKLIISVTAIFTFIALLYVLFATPIYQADSLVQIEQKQGNSLINSLNQALT
              DDVDLARLVGEIIDHRKLIISVTAIFTFIALLYVLFATPIYQADSLVQIEQKQGNSLINSLNQALT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSQPQSAPELALLQSRMILGKTVDDLNLQIIAKQDYFPIIGRGWARLTGQENNSVLISQFDAPSTLDSEAEVTMTVISAN
DSQPQSAPELALLQSRMILGKTVDDLNLQIIAKQDYFPIIGRGWARLTGQENNSVLISQFDAPSTLDSEAEVTMTVISAN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYVIDHDGNIVKGKVGVLLKNNDLTFMVTKIDAEPNSKFIVTKKTKLEAINNLQKFFSVADQGKDTGILNLTIQGDNPAL
EYVIDHDGNIVKGKVGVLLKNNDLTFMVTKIDAEPNSKFIVTKKTKLEAINNLQKFFSVADQGKDTGILNLTIQGDNPAL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKILDSISQNYLAQNIDRQAAQDAKSLDFLNEQLPKIRKDLDTAEDKLNYYRQQKDSVDLSLEAKAILDQIVNVDNQLN
LRKILDSISQN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELTFREAEISQLFTKEHPTYKSLIEKRTILEKEKERLNKKVSAMPATQQEVLRLSRDVDSGRAVYMQLLNRQQELNIAKS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIGNVRIIDNAVTEPVPVKPKKFIVILIGLVLGIVFSVSVVIIKTFFNKGIESPEQLEELGVNVYASIPVSEWLLSNKG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTKGLSHKGKFKKQEHSFLAIENPADLAIEAIRGLRTSLHFAMMEAKNNVLMISGATPDAGKTFISSNLSAIIAQTGKKI
                                                     SGATPDAGKTFISSNLSAIIAQTGKKI
                                                            GKT                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFIDADMRKGYVHKLLLTGQDNCKGLSEVLSSNENFEKVVHNINFANFDFIARGQIPPNPAELLMHKRFEELMTWAMENY
LFIDADMRKGYVHKLLLTGQDNCKGLSEVLSSNENFEKVVHNINFANFDFIARGQIPPNPAELLMHKRFEELMTWAMENY
LFIDADMR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLIIIDTPPILAVTDAAVIGRYAGTSLLVARFEENTPKEIYFAVKRFEQNGVTVKGCILNGVVKKASSYYGYGYNSYGYT
DLIIIDTPPILAVTDAAVIGRYAGTSLLVARFEENTPKEIYFAVKRFEQNGVTVKGCILNGVVKKASSYYGYGYNSYGYT
  IIIDTPP                                                           YYGYGYNSYGYT
     
....:
YKDDK
YKDDK
Y    

© 1998-2019