BYKdb

Annotate results for A0A0P1EFX8

A0A0P1EFX8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P1EFX8
DOMAINcd96/279VSPHSACGKSTTTANLAFSFGRQTDLRTVVLDFDLRRAGLSLMLKQDCQCTMGDILQGKA
LLSDHGYRVGKNVALGLSSGAVTDAAEILQSQKASDVIAAIEAEFEPDLVLFDMPPLLAA
DDNFGFLKNADCALLMTEAERTTIDQIDVAERQLAELTNVMGVIMNKCHYTDGIYGYGYG
YGYS
SITEWalker A103/105GKS
SITEWalker A'124/131VVLDFDLR
SITEWalker B205/211VLFDMPP
SITEY Cluster265/278YTDGIYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKLQKAIEKARSQRRKRAPAQLAVAADKAIQEEVPSNRTTDPWLDLTPLDISKTDVRQNRLVSYDGGAAAGPYDMLRTR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILQQALVNGWKRVAMVSPHSACGKSTTTANLAFSFGRQTDLRTVVLDFDLRRAGLSLMLKQDCQCTMGDILQGKALLSDH
               VSPHSACGKSTTTANLAFSFGRQTDLRTVVLDFDLRRAGLSLMLKQDCQCTMGDILQGKALLSDH
                      GKS                  VVLDFDLR                             
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYRVGKNVALGLSSGAVTDAAEILQSQKASDVIAAIEAEFEPDLVLFDMPPLLAADDNFGFLKNADCALLMTEAERTTID
GYRVGKNVALGLSSGAVTDAAEILQSQKASDVIAAIEAEFEPDLVLFDMPPLLAADDNFGFLKNADCALLMTEAERTTID
                                            VLFDMPP                             
       250       260       270         
....:....|....:....|....:....|....:....
QIDVAERQLAELTNVMGVIMNKCHYTDGIYGYGYGYGYS
QIDVAERQLAELTNVMGVIMNKCHYTDGIYGYGYGYGYS
                        YTDGIYGYGYGYGY 
© 1998-2019