BYKdb

Annotate results for A0A0P1FRV5

A0A0P1FRV5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P1FRV5
DOMAINcd180/364TSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEI
ETRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFD
LPPALANDDVITFKSNFDGVLIVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATG
DEYGY
SITEWalker A187/189GKT
SITEWalker A'208/215VLMDMDMR
SITEWalker B296/302VLFDLPP
SITEY Cluster362/364YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEVPAEVTDAAPVQRRGLLSGSGRSAEEIAREDRALRSAFPFLDLDDV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EADASELAEEVAPVAVPEPLILNPESEVTPEPETEQPSEQPPGDDGWNDLGPMPVQRQQMMRNLIITASRKNPVHAAFDV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRARLVQALSDNGWRRVAITSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIE
                   TSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIE
                          GKT                  VLMDMDMR                         
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVITFKSNFDGVL
TRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVITFKSNFDGVL
                                                       VLFDLPP                  
       330       340       350       360    
....:....|....:....|....:....|....:....|....
IVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATGDEYGY
IVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATGDEYGY
                                         YGY
© 1998-2019