BYKdb

Annotate results for A0A0P1GDI0

A0A0P1GDI0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P1GDI0
DOMAINcd426/610TSPGKDCGKTFTAANLAISLSRQENCRTLLMDCDMRRPSLHKIMGIDTPGAMGELLRGNI
DPADHLVRMGSNQIHAGKNIAFGFNDLAEPYASELLQDPRTAQTLDRIEELYQPDVMLFD
LPPALFYDDVIAARPLIDGVLLVIGGGLTTEKEVKEVERRLGEQTPLLGMVLNKAEGTEI
DRYRY
SITEWalker A433/435GKT
SITEWalker A'454/461LLMDCDMR
SITEWalker B542/548MLFDLPP
SITEY Cluster608/610YRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTERRKFRRKNRSADAVEDEMPPIAPLESREERLARRRAEQEAEQARLAAEEAARVEAERLEQARLEEQARQEALARKAE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAEKQRLAEEQAKAEAEEKARLAAEAEAQAEAARLAKL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEERAAEAKRKQAELAAQRKAEAEAAERAEKQRKQAEADRRAQEKAKEAQRQAERAAAQRQAEEAARHKAKAAAEQQARM


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAEAAQRAEEARRAAHQADIDLARESERVRREKAERLAAKQVAQAEADRLAAEQAAQAEADRLAAEQAAQAKAEQAKADR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARKTETERRAQEARARAALRHDLTPEPEADPESAEAEPETAPETLPAPFDDPWAQLQTFTVDPAHLSQNRIITAQRDDPA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAAFDVLRTRLLQALHDNGWKRVAITSPGKDCGKTFTAANLAISLSRQENCRTLLMDCDMRRPSLHKIMGIDTPGAMGEL
                         TSPGKDCGKTFTAANLAISLSRQENCRTLLMDCDMRRPSLHKIMGIDTPGAMGEL
                                GKT                  LLMDCDMR                   
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRGNIDPADHLVRMGSNQIHAGKNIAFGFNDLAEPYASELLQDPRTAQTLDRIEELYQPDVMLFDLPPALFYDDVIAARP
LRGNIDPADHLVRMGSNQIHAGKNIAFGFNDLAEPYASELLQDPRTAQTLDRIEELYQPDVMLFDLPPALFYDDVIAARP
                                                             MLFDLPP            
       570       580       590       600       610
....:....|....:....|....:....|....:....|....:....|
LIDGVLLVIGGGLTTEKEVKEVERRLGEQTPLLGMVLNKAEGTEIDRYRY
LIDGVLLVIGGGLTTEKEVKEVERRLGEQTPLLGMVLNKAEGTEIDRYRY
                                               YRY
© 1998-2019