BYKdb

Annotate results for A0A0P1GKW9

A0A0P1GKW9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P1GKW9
DOMAINcd67/253TSSAMSEGKSTVSANVAVTWAQSGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNT
PEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLDWARNNFDIIVLDAPPVLAVSD
VQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKLANAKILGSVERVKAKHGDRGYGYGYG
YGYGNEK
SITE-204/-206GKT
SITEWalker A'94/101LLIDADLR
SITEWalker B174/180IVLDAPP
SITEY Cluster241/249YGYGYGYGY
SITEWalker A74/76GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRGKSMNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSA
                                                                  TSSAMSEGKSTVSA
                                                                         GKS    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVAVTWAQSGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRM
NVAVTWAQSGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRM
             LLIDADLR                                                           
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKLLDWARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKLANAKILGSVERVKAKHGDRG
GKLLDWARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKLANAKILGSVERVKAKHGDRG
             IVLDAPP                                                            
       250   
....:....|...
YGYGYGYGYGNEK
YGYGYGYGYGNEK
YGYGYGYGY    
© 1998-2019