BYKdb

Annotate results for A0A0P1H2H0

A0A0P1H2H0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P1H2H0
DOMAINcd203/387TSPTRDCGKTFVAVNLAVALSRYENCRTLLMDMDMRNPSVSKILSLRDVGSMGDYLRGQI
ATRDQFFKFDRNDLKIGENLAVAMNEQPEPFASELLQQPETRDRLNQMEEELHPDVVLFD
LPPALANDDVIAFKGRFDGVLIVIDGTRSSAAEVREVMRRLGDDVPLLGVVLNKAEDASG
DEYRY
SITEWalker A210/212GKT
SITEWalker A'231/238LLMDMDMR
SITEWalker B319/325VLFDLPP
SITEY Cluster385/387YRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVEQSKKVLRQKRQARRAARAARAAEGTQANVMADVEAPAPVKDDAPQATGFLGLSGRSADDIAQEDRALRAAFPQWDGD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMQDAASDTTEMDAPHSHNDEALPDEPAAEPLLLTPAVAAVPFDHIPSPDSVTTAPEEQDYPTEPEMDEWPLLGTMPVQR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHLGRNLVITASRRNPVHAAFDVLRARLVQALSENGWKRVGITSPTRDCGKTFVAVNLAVALSRYENCRTLLMDMDMRNP
                                          TSPTRDCGKTFVAVNLAVALSRYENCRTLLMDMDMRNP
                                                 GKT                  LLMDMDMR  
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSKILSLRDVGSMGDYLRGQIATRDQFFKFDRNDLKIGENLAVAMNEQPEPFASELLQQPETRDRLNQMEEELHPDVVL
SVSKILSLRDVGSMGDYLRGQIATRDQFFKFDRNDLKIGENLAVAMNEQPEPFASELLQQPETRDRLNQMEEELHPDVVL
                                                                              VL
       330       340       350       360       370       380       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
FDLPPALANDDVIAFKGRFDGVLIVIDGTRSSAAEVREVMRRLGDDVPLLGVVLNKAEDASGDEYRY
FDLPPALANDDVIAFKGRFDGVLIVIDGTRSSAAEVREVMRRLGDDVPLLGVVLNKAEDASGDEYRY
FDLPP                                                           YRY
© 1998-2019