BYKdb

Annotate results for A0A0P6WE77

A0A0P6WE77 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P6WE77
DOMAINcd43/224TSSGPGEGKSTTSANLGVVFAQEGKRVLLVDADMRKPTAHYTFGLNNTFGLTSVLTRQKS
LTEVTHSSDVKNLDLLTCGPIPPNPAELLNSKRMEHFFKEVHEEYDMVIFDTPPVLAVTD
GQILANQCQGTILVISSGTTEVDRAVKSKELLEAAKAKLVGVVLNNREMKDSNYYYYYGG
NK
SITEWalker A50/52GKS
SITEWalker A'70/77LLVDADMR
SITEWalker B150/156VIFDTPP
SITEY Cluster216/220YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTKRKLITKTDPMSPISEQYKTIRTNINFSFIDQELRSLMVTSSGPGEGKSTTSANLGVVFAQEGKRVLLVDADMRKPT
                                          TSSGPGEGKSTTSANLGVVFAQEGKRVLLVDADMRKPT
                                                 GKS                 LLVDADMR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHYTFGLNNTFGLTSVLTRQKSLTEVTHSSDVKNLDLLTCGPIPPNPAELLNSKRMEHFFKEVHEEYDMVIFDTPPVLAV
AHYTFGLNNTFGLTSVLTRQKSLTEVTHSSDVKNLDLLTCGPIPPNPAELLNSKRMEHFFKEVHEEYDMVIFDTPPVLAV
                                                                     VIFDTPP    
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
TDGQILANQCQGTILVISSGTTEVDRAVKSKELLEAAKAKLVGVVLNNREMKDSNYYYYYGGNK
TDGQILANQCQGTILVISSGTTEVDRAVKSKELLEAAKAKLVGVVLNNREMKDSNYYYYYGGNK
                                                       YYYYY    
© 1998-2019