BYKdb

Annotate results for A0A0P6XM68

A0A0P6XM68 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P6XM68
DOMAINtad1/131MEIKEYLQIARRWAWLLILGLLLGAVSAFFFANSQTRIYESSIRVQIVSAVKTVPNMDYN
SYVEQNQLAQTYVQTLRSRPVLDAVAERINTAITPEQIRAQIVQNTQLIDIFVTDTDPQR
AASIANTLVEV
DOMAINcd413/601VSAHPGEGKSTVATNLAITMAQGGKKTLLIDADLRRPRVHQYLNLPNRVGLSNLFRDAKS
LHEVMGQWKETTLQVITSGGLPPNPTDLLASDRMAAVLQSALEEADVVVVDAPPFLVADA
SILASRVDGVLFVIHPGRTPVDAAQATLEQMRRVGANVLGLVLNRIPRNRPNYYGGYRYY
SGYYKGEYS
SITEWalker A420/422GKS
SITEWalker A'440/447LLIDADLR
SITEWalker B520/526VVVDAPP
SITEY Cluster585/603YYGGYRYYSGYYKGEYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEIKEYLQIARRWAWLLILGLLLGAVSAFFFANSQTRIYESSIRVQIVSAVKTVPNMDYNSYVEQNQLAQTYVQTLRSRP
MEIKEYLQIARRWAWLLILGLLLGAVSAFFFANSQTRIYESSIRVQIVSAVKTVPNMDYNSYVEQNQLAQTYVQTLRSRP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDAVAERINTAITPEQIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEVFIERNSRMQAERFNESERSLEAQIAQIDA
VLDAVAERINTAITPEQIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEV                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIEALQSRSTAATTEQSEQQIEKAKSELDRLQTEILAIRTALDTLRSPKAEAGWYSTPTPSPEIRAEINQKELELKELET


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYDLYQQIYTNLVVLGESRNENSANVEQEQMQSTLALYRQIHANLLSSYENIRLARLSSTSNIVSIEPAIPPEEPLSPKP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRTGLLGGTVGLLLAAGIVFLIEYLDDTVKSAEQAEAALGVPVIGFIAELEHDQDKAYVAENPRSPVSEAFRTLRTNLEF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGVDRPIRSILVVSAHPGEGKSTVATNLAITMAQGGKKTLLIDADLRRPRVHQYLNLPNRVGLSNLFRDAKSLHEVMGQW
            VSAHPGEGKSTVATNLAITMAQGGKKTLLIDADLRRPRVHQYLNLPNRVGLSNLFRDAKSLHEVMGQW
                   GKS                 LLIDADLR                                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KETTLQVITSGGLPPNPTDLLASDRMAAVLQSALEEADVVVVDAPPFLVADASILASRVDGVLFVIHPGRTPVDAAQATL
KETTLQVITSGGLPPNPTDLLASDRMAAVLQSALEEADVVVVDAPPFLVADASILASRVDGVLFVIHPGRTPVDAAQATL
                                       VVVDAPP                                  
       570       580       590       600       610       620       630       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
EQMRRVGANVLGLVLNRIPRNRPNYYGGYRYYSGYYKGEYSYYDDEARGNGKKHSTFRWRTRKNQTQEEKTAESGQE
EQMRRVGANVLGLVLNRIPRNRPNYYGGYRYYSGYYKGEYS                                    
                        YYGGYRYYSGYYKGEYSYY                                  
© 1998-2019