BYKdb

Annotate results for A0A0P6XME1

A0A0P6XME1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P6XME1
DOMAINtad1/129MQPRDYLVLIRRWLWLLGVGIFVGALGGLVFSLLQKPIYQASTKVMVLGVPQSNLSDILN
QNSELLSQTFTELLVTRPVLEAASERLGYYINSSQVRVQQVRGAQLIQIIVEDSIPEKAA
EIANTLVTV
DOMAINcd421/609GSPSPDEGKTTIAVNLAIVIAQAGKRVLLIDTDMRRPQIHERLRLPNRFGLSDILREHGS
LDESLHHLATEGIDVITSGILPPNPAEVLSSERMAKLMEEVAQRYDKVILDGPPFLISDA
IVLASRVDGVLLVLRARNTSQSVALEVLDQLDRVKARVVGAVLNRVQDTTSNHYYRSLKS
YTYVSKETD
SITEWalker A428/430GKT
SITEWalker A'448/455LLIDTDMR
SITEWalker B528/534VILDGPP
SITEY Cluster594/603YYRSLKSYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQPRDYLVLIRRWLWLLGVGIFVGALGGLVFSLLQKPIYQASTKVMVLGVPQSNLSDILNQNSELLSQTFTELLVTRPVL
MQPRDYLVLIRRWLWLLGVGIFVGALGGLVFSLLQKPIYQASTKVMVLGVPQSNLSDILNQNSELLSQTFTELLVTRPVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAASERLGYYINSSQVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTVFLEQNAKIQSSRFSASEESLQAQIQQVEAQI
EAASERLGYYINSSQVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTV                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLQRQLAQTSEQSNEKRIQDVTNIISGLQSEINQLQADIVRIEAERDPILGVNSLGQPARVTPTLTVDQQIELTQKRSR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDELRSLLSIYQQIYVNLTFSPSNQGNSNSTNSQLQAALVLYQQIYANLLSNYEAIRLARLQSTPEVVQVEEARVPSRPV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPQTTTNVLLGGILGLVLAAGIVFVVEYLDDSIRNGETVTRVLELPVLGYINEINGKTPYEDYPPHVIAQPRSLITEAFR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIRTNLEFVEIDRPLKTLLVGSPSPDEGKTTIAVNLAIVIAQAGKRVLLIDTDMRRPQIHERLRLPNRFGLSDILREHGS
                    GSPSPDEGKTTIAVNLAIVIAQAGKRVLLIDTDMRRPQIHERLRLPNRFGLSDILREHGS
                           GKT                 LLIDTDMR                         
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDESLHHLATEGIDVITSGILPPNPAEVLSSERMAKLMEEVAQRYDKVILDGPPFLISDAIVLASRVDGVLLVLRARNTS
LDESLHHLATEGIDVITSGILPPNPAEVLSSERMAKLMEEVAQRYDKVILDGPPFLISDAIVLASRVDGVLLVLRARNTS
                                               VILDGPP                          
       570       580       590       600       610      
....:....|....:....|....:....|....:....|....:....|....:.
QSVALEVLDQLDRVKARVVGAVLNRVQDTTSNHYYRSLKSYTYVSKETDELTLLEN
QSVALEVLDQLDRVKARVVGAVLNRVQDTTSNHYYRSLKSYTYVSKETD       
                                 YYRSLKSYTY             
© 1998-2019