BYKdb

Annotate results for A0A0P7DR08

A0A0P7DR08 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P7DR08
DOMAINtad1/245MLALLWHRRWWLIGSTLLFTLLGIYLVGSQQRIYLADSLIQIEDKGGSASLLGPLAGQAT
GSDESSTSDELEILTSRLVLGQAVDRERLNIVVSPMRYPVIGDWLSNRHLRLPASLGGQD
YAWGDDTLKVTTLELSGPWQQQTLTLEALGDERYRLLDAEGQAIVDGKVGENALAEGIKV
FVRELSAEPGARFTLTSISDLSAINSLKSRFTAVRNGTDTGVVTLSLSGSDQTAIVNTLD
TITNV
DOMAINcd527/712TGPSPGIGKSFVSLNLAAVSAEAGQRVLLIDADMRRGHLHHAFQRTSEQGGLSDVLSGAS
PLDSVLYHSRIDNLDFLGRGVAPPNPSELLMQPNFAELLEQLGERYDLIIIDTPPVLAVT
EALIIGRHVGASLMVARFGMNQVRELEHARKKLENNGIHVKGAILNAIEPQAGDKHGYGY
YNYSYA
SITEWalker A534/536GKS
SITEWalker A'554/561LLIDADMR
SITEWalker B635/641IIIDTPP
SITEY Cluster704/711YGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLALLWHRRWWLIGSTLLFTLLGIYLVGSQQRIYLADSLIQIEDKGGSASLLGPLAGQATGSDESSTSDELEILTSRLVL
MLALLWHRRWWLIGSTLLFTLLGIYLVGSQQRIYLADSLIQIEDKGGSASLLGPLAGQATGSDESSTSDELEILTSRLVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQAVDRERLNIVVSPMRYPVIGDWLSNRHLRLPASLGGQDYAWGDDTLKVTTLELSGPWQQQTLTLEALGDERYRLLDAE
GQAVDRERLNIVVSPMRYPVIGDWLSNRHLRLPASLGGQDYAWGDDTLKVTTLELSGPWQQQTLTLEALGDERYRLLDAE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQAIVDGKVGENALAEGIKVFVRELSAEPGARFTLTSISDLSAINSLKSRFTAVRNGTDTGVVTLSLSGSDQTAIVNTLD
GQAIVDGKVGENALAEGIKVFVRELSAEPGARFTLTSISDLSAINSLKSRFTAVRNGTDTGVVTLSLSGSDQTAIVNTLD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TITNVFLQQNIERESAEADNQLGFLGDQIPTLRGQLDEAESALNDYRRRRDSVDLTAESQQVMENLVGLDNQLTEIKLRL
TITNV                                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELSRAYTSEHPAYRALVARRDSLNQEKARVQKQAEQLPAAQREALNLNRNVTVSQEIYVALLNKREEVRLKKAGTVGNV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RILDPAVLQPVPISPKTSLMLAVFCMIGLMLGTLAALLRHAMRKGIDTAEQIEALDLPVYATVPLSPQQHNMMRRVRLKG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGGREIYQGVLATSQPSDISIEALRSLRTSLHFALLDNRRKSVMFTGPSPGIGKSFVSLNLAAVSAEAGQRVLLIDADM
                                              TGPSPGIGKSFVSLNLAAVSAEAGQRVLLIDADM
                                                     GKS                 LLIDADM
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRGHLHHAFQRTSEQGGLSDVLSGASPLDSVLYHSRIDNLDFLGRGVAPPNPSELLMQPNFAELLEQLGERYDLIIIDTP
RRGHLHHAFQRTSEQGGLSDVLSGASPLDSVLYHSRIDNLDFLGRGVAPPNPSELLMQPNFAELLEQLGERYDLIIIDTP
R                                                                         IIIDTP
       650       660       670       680       690       700       710  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
PVLAVTEALIIGRHVGASLMVARFGMNQVRELEHARKKLENNGIHVKGAILNAIEPQAGDKHGYGYYNYSYA
PVLAVTEALIIGRHVGASLMVARFGMNQVRELEHARKKLENNGIHVKGAILNAIEPQAGDKHGYGYYNYSYA
P                                                              YGYYNYSY 

© 1998-2019