BYKdb

Annotate results for A0A0P7FX18

A0A0P7FX18 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P7FX18
DOMAINtad1/135MDMREQILILRRNWMLIVSFALSGLIAAAVVSVAMPKAYTASSSLFVSTQNVDTSAELQQ
GSAFALARVQSYVNLASKPQVLDPVIEELELNTSSAELAKNVKASTSRNTVIIEIKAVDS
DPQRAADIANGVVSS
DOMAINcd265/453TSAQAGEGKSTVSLNLALSMAQSGRRVLLVDADLRLPSVADATGLEPSVGLTTVLVGRTN
LSDATQHWGNAGLSILTSGPLPPNPTELLASSTMQKLIGEMEAAYDVVIFDAPPVLPVAD
AAILTRHTDSLLLVVGARKVSQHNLSKAVEQLNLVKANVIGVVLNGIPRSGPDANSAYLT
DYGAVPASP
SITEWalker A272/274GKS
SITEWalker A'292/299LLVDADLR
SITEWalker B372/378VIFDAPP
SITEY Cluster442/446YLTDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDMREQILILRRNWMLIVSFALSGLIAAAVVSVAMPKAYTASSSLFVSTQNVDTSAELQQGSAFALARVQSYVNLASKPQ
MDMREQILILRRNWMLIVSFALSGLIAAAVVSVAMPKAYTASSSLFVSTQNVDTSAELQQGSAFALARVQSYVNLASKPQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIEELELNTSSAELAKNVKASTSRNTVIIEIKAVDSDPQRAADIANGVVSSLILAVADVERPTNGTPSPVRLTSVD
VLDPVIEELELNTSSAELAKNVKASTSRNTVIIEIKAVDSDPQRAADIANGVVSS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAQAPSAPSSPKTSLNLALGLLYGMAAGLAVAVLRNVLDRHVRTEADLRRSTSLPLLGGITESEAPKGSSAPFVLGGSGT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAFRQLRTNLEFAAVGHAMKSLLVTSAQAGEGKSTVSLNLALSMAQSGRRVLLVDADLRLPSVADATGLEPSVGLTTVLV
                        TSAQAGEGKSTVSLNLALSMAQSGRRVLLVDADLRLPSVADATGLEPSVGLTTVLV
                               GKS                 LLVDADLR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRTNLSDATQHWGNAGLSILTSGPLPPNPTELLASSTMQKLIGEMEAAYDVVIFDAPPVLPVADAAILTRHTDSLLLVVG
GRTNLSDATQHWGNAGLSILTSGPLPPNPTELLASSTMQKLIGEMEAAYDVVIFDAPPVLPVADAAILTRHTDSLLLVVG
                                                   VIFDAPP                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARKVSQHNLSKAVEQLNLVKANVIGVVLNGIPRSGPDANSAYLTDYGAVPASPLDGEQHSGRPSSPIAEAAEVVNGDRGR
ARKVSQHNLSKAVEQLNLVKANVIGVVLNGIPRSGPDANSAYLTDYGAVPASP                           
                                         YLTDY                                  
       490
....:....|
NSRRKQAVKN


© 1998-2019