BYKdb

Annotate results for A0A0P7L2Z9

A0A0P7L2Z9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P7L2Z9
DOMAINtad11/251SSIDLRQLLTILYRHKLPIGTAIAAGFIVGGLYSMSAQPVYRADALLAVEVQSNQILPQL
NAGALPQRGMNGSSPDAEIDLIKSRSVIGQTVDNLQLDLDIQPAYTPIIGSTLAKFSNAG
QPTIKVERFTVPEDFENQTFGLKVESPNSYILTTPDGESLEGKVGKPLKFSNNGEFFINQ
ILAETGQSFSITKLSRLKAINNITDNLSVSAQGEGSPLITLGYTGTERKKIETVLNHIID
N
DOMAINcd532/714AGTTPGVGKSFVSSNLATVTAQAGSRVLLVDADLRRGMLHHSFGLTEENGLAEILDGSST
FDASIKHTDVPGLDFISRGHSPQSPSEMLMSDKFKEFIATAKDKYDYVIIDTPPVLAVTD
SSIIGRVADLTLLIARYRKTSHDELEDSMSRLNNAGIKVEGVIFNGVERTARNYYQYQTY
TGK
SITEWalker A539/541GKS
SITEWalker A'559/566LLVDADLR
SITEWalker B639/645VIIDTPP
SITE-636/-638YDY
SITEY Cluster705/711YYQYQTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATKSTQAFESSIDLRQLLTILYRHKLPIGTAIAAGFIVGGLYSMSAQPVYRADALLAVEVQSNQILPQLNAGALPQRGM
          SSIDLRQLLTILYRHKLPIGTAIAAGFIVGGLYSMSAQPVYRADALLAVEVQSNQILPQLNAGALPQRGM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGSSPDAEIDLIKSRSVIGQTVDNLQLDLDIQPAYTPIIGSTLAKFSNAGQPTIKVERFTVPEDFENQTFGLKVESPNSY
NGSSPDAEIDLIKSRSVIGQTVDNLQLDLDIQPAYTPIIGSTLAKFSNAGQPTIKVERFTVPEDFENQTFGLKVESPNSY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILTTPDGESLEGKVGKPLKFSNNGEFFINQILAETGQSFSITKLSRLKAINNITDNLSVSAQGEGSPLITLGYTGTERKK
ILTTPDGESLEGKVGKPLKFSNNGEFFINQILAETGQSFSITKLSRLKAINNITDNLSVSAQGEGSPLITLGYTGTERKK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IETVLNHIIDNYVSQNKNRDVQMATSGLAFISEELPRLKQSLQDAETKLNQYRTNTGSVDIPSEAQGALRSLTDIETQIT
IETVLNHIIDN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLRAEEAGMSELYTPEHPSYKSVRDRLKVLEEARDRINRQISTLPQTEQEVIRLNRDVEINQATYVQLLNRQQELNILKA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQGNIRVIDPAVAEEKPFKPRRAMITLLSAIAAGLLASSLFVLRAIARPTIKVSDDIRAMGYNLISTIPASNTQMKADK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYNRLSAGKSKHPQYLLANIHTNDVAVETIRALRTNLHFATINNKSSMIMIAGTTPGVGKSFVSSNLATVTAQAGSRVLL
                                                   AGTTPGVGKSFVSSNLATVTAQAGSRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRRGMLHHSFGLTEENGLAEILDGSSTFDASIKHTDVPGLDFISRGHSPQSPSEMLMSDKFKEFIATAKDKYDYVI
VDADLRRGMLHHSFGLTEENGLAEILDGSSTFDASIKHTDVPGLDFISRGHSPQSPSEMLMSDKFKEFIATAKDKYDYVI
VDADLR                                                                        VI
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
IDTPPVLAVTDSSIIGRVADLTLLIARYRKTSHDELEDSMSRLNNAGIKVEGVIFNGVERTARNYYQYQTYTGK
IDTPPVLAVTDSSIIGRVADLTLLIARYRKTSHDELEDSMSRLNNAGIKVEGVIFNGVERTARNYYQYQTYTGK
IDTPP                                                           YYQYQTY   

© 1998-2019