BYKdb

Annotate results for A0A0P7W5P3

A0A0P7W5P3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P7W5P3
DOMAINtad39/207FDFSIGDILTVLWERKWWILLAALLGLVAALGYSLSKSPLYRATATIELNPPSVPVLSNG
GDASEGLVVPTTDSQFQETQIGILRSRALAERVVQDLGLVGESNRFDAAETSGAEAAAAR
DPQRVAGLAASIAEGLTVSPSPNSRLIELSYVSDDPAEAARLANGFATS
DOMAINcd543/728TSSRPEEGKSSTSYSLGVQLSDTGRRVLLIDADMRKPSFVVSEDDRIGLSTLLTSDTSLT
EHVVKTTSPNLFLLPSGPIPPNPANIILPARLDAILANARSLFDHVIIDAPPVARFADAV
LLSSCSDGVLFTLESGKTRTALARAALSQLRMAGANLLGGSLTKASARVIDYGYGRYQSY
YGGASR
SITE-678/-680GKT
SITEWalker A'570/577LLIDADMR
SITEWalker B648/654VIIDAPP
SITEY Cluster714/723YGYGRYQSYY
SITEWalker A550/552GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSQEQLPPRAPRDALVERQQGALSPYLADEMIDDEDEFDFSIGDILTVLWERKWWILLAALLGLVAALGYSLSKSPLYR
                                      FDFSIGDILTVLWERKWWILLAALLGLVAALGYSLSKSPLYR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATATIELNPPSVPVLSNGGDASEGLVVPTTDSQFQETQIGILRSRALAERVVQDLGLVGESNRFDAAETSGAEAAAARDP
ATATIELNPPSVPVLSNGGDASEGLVVPTTDSQFQETQIGILRSRALAERVVQDLGLVGESNRFDAAETSGAEAAAARDP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRVAGLAASIAEGLTVSPSPNSRLIELSYVSDDPAEAARLANGFATSFIDLTLDRKYEATTSARRFLEERIRTVREEIND
QRVAGLAASIAEGLTVSPSPNSRLIELSYVSDDPAEAARLANGFATS                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AERRLVAYAKENGIVLVGSGEGEGGAGSSTLTGESLGTLNSALAAAQQKRITAEQRYRQAAALAAGGGNSATLRQEKAVL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAEYREKSTYLQDSFPEMARLKTRIEELDRQILTENSRATGTLEAEYRAALAEEQALSERVSQLTGSALTEREDAIQYNI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRELDTNRSLYDALLERYNEVGVVEGIGTAQAATVDQAQAPSTPFEPNILRNTILGTLLGLFLGAGLAVLYDRLTDTVK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKDDLREKLGLPALGAIPLATKNANFLEEVRDQYSVIYDAYASLRTGLQLSGEGGFPQVLLVTSSRPEEGKSSTSYSLGV
                                                              TSSRPEEGKSSTSYSLGV
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSDTGRRVLLIDADMRKPSFVVSEDDRIGLSTLLTSDTSLTEHVVKTTSPNLFLLPSGPIPPNPANIILPARLDAILAN
QLSDTGRRVLLIDADMRKPSFVVSEDDRIGLSTLLTSDTSLTEHVVKTTSPNLFLLPSGPIPPNPANIILPARLDAILAN
         LLIDADMR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARSLFDHVIIDAPPVARFADAVLLSSCSDGVLFTLESGKTRTALARAALSQLRMAGANLLGGSLTKASARVIDYGYGRYQ
ARSLFDHVIIDAPPVARFADAVLLSSCSDGVLFTLESGKTRTALARAALSQLRMAGANLLGGSLTKASARVIDYGYGRYQ
       VIIDAPP                                                           YGYGRYQ
       730       740    
....:....|....:....|....
SYYGGASRGDDTTIAIAAAPDRAT
SYYGGASR                
SYY                     

© 1998-2019