BYKdb

Annotate results for A0A0P7X1V8

A0A0P7X1V8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P7X1V8
DOMAINtad38/209DEIDLLQIFGLLWHNKWIIITLTLLGGVSAYIYAQSQIPIFESNGSLQITEAGNRYSMAG
SDLSNLMVSNFGIGMGSSIENEIHVLQSRTFTGELAQRIYDERYQPDGRLYPVIWRAFPE
DSSIVTADTVFARLYGNLTFTRADRNSNLLRVSYRSPSPYEASRVVDLAIET
DOMAINcd599/788TSANKSEGKSTVSTNLCVALAEAGKRVLLVDCDFRRPRVHSYFGREQEPGSMDILFGGQE
PTDVIQKTLVPGVEILTSGKRPPNPAEITRSAKLRELIRSVKNDYDHIIIDSPPFGIISD
AAPLIGEADGVILVARFNQTKSPELDLTIDNLKKVKANVIGTVMTAFDPKKSTGYYYSSY
YYKYAYESYD
SITEWalker A606/608GKS
SITEWalker A'626/633LLVDCDFR
SITEWalker B706/712IIIDSPP
SITEY Cluster773/790YYYSSYYYKYAYESYDKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDEIDLLQIFGLLWHNKWIIITLTLLGGVSAYIYAQSQIPIFES
                                     DEIDLLQIFGLLWHNKWIIITLTLLGGVSAYIYAQSQIPIFES

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGSLQITEAGNRYSMAGSDLSNLMVSNFGIGMGSSIENEIHVLQSRTFTGELAQRIYDERYQPDGRLYPVIWRAFPEDSS
NGSLQITEAGNRYSMAGSDLSNLMVSNFGIGMGSSIENEIHVLQSRTFTGELAQRIYDERYQPDGRLYPVIWRAFPEDSS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVTADTVFARLYGNLTFTRADRNSNLLRVSYRSPSPYEASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQL
IVTADTVFARLYGNLTFTRADRNSNLLRVSYRSPSPYEASRVVDLAIET                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYSEEQLRDFMNQNQLVQLDAQAQQLIETLSTLEAESQGIQVKLVAANSALEAYQQELDRLTPGLSEQLTASIAPRINQL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVFLADRETQRTLLLSRNPQLRNTPDDPSLIEINQQIEGLREEIARLTNDLIQSDAGLSFFGSSDGNVSNRFMTLRNEVL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLEVERQQLEAQRNLLEERAAEYRAFFEDLPDNMIEMARYQRNMQINEQLFLLISQQAAETALWEQTQSGLARVVDMSFI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRSPVAPRKMIILLVGLMLGGVIAVGFVSIREFFKVEISSIDKLMKKGYPLLTIIPDMNRHIKENFDGAEYVTIRGNTLS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLVMVLDSISPLAESFRRLQSNVSYSQPDNPLKTIIVTSANKSEGKSTVSTNLCVALAEAGKRVLLVDCDFRRPRVHSY
                                      TSANKSEGKSTVSTNLCVALAEAGKRVLLVDCDFRRPRVHSY
                                             GKS                 LLVDCDFR       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGREQEPGSMDILFGGQEPTDVIQKTLVPGVEILTSGKRPPNPAEITRSAKLRELIRSVKNDYDHIIIDSPPFGIISDAA
FGREQEPGSMDILFGGQEPTDVIQKTLVPGVEILTSGKRPPNPAEITRSAKLRELIRSVKNDYDHIIIDSPPFGIISDAA
                                                                 IIIDSPP        
       730       740       750       760       770       780       790    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
PLIGEADGVILVARFNQTKSPELDLTIDNLKKVKANVIGTVMTAFDPKKSTGYYYSSYYYKYAYESYDKYHEEA
PLIGEADGVILVARFNQTKSPELDLTIDNLKKVKANVIGTVMTAFDPKKSTGYYYSSYYYKYAYESYD      
                                                    YYYSSYYYKYAYESYDKY    

© 1998-2019