BYKdb

Annotate results for A0A0P7Y1D0

A0A0P7Y1D0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P7Y1D0
DOMAINcd447/639TSALPGEGKTTTTYSLGRISAMSGSKTIILDCDLRRRLLTKAAAPDAQKGLMEVLAGEAT
LDEVLMDDAEPGLHILPVVESQFTPRDVFSSDAFKSLLAVLRQRYDLVLIDTAPVLAVTD
TRVIAARADAVVVSVKWKTTPREAAASAIDILRDVNANVLGVALSQVDMNAQARYGYEGS
SYYYKNYRSYYSG
SITEWalker A454/456GKT
SITEWalker A'474/481IILDCDLR
SITEWalker B554/560VLIDTAP
SITEY Cluster621/637YGYEGSSYYYKNYRSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSELDLAADPEFNSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAVTSAVLDRLSARRSGMTFMLTIAFT


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SENAAKAARIANAFADQYLLSQLEAKFDATERANTWLNERLETLREEVRTDEQAVEMYRAENGLLDTGGSTLTEQQISDL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAQLAIQRAELSAAESSLRNVQTQLERGASLDTIGEVLRSETIRALRAQQTDTSRRRSDLTSRYGPRHPEILAVEREAAD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEEQVNREIQRIVAGLETEVNVARQRVGSLQSTLSGVRDELVTNNRALVQLRELEREAEASRTLFESFLNRFRQTSEQND


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATADARIVARAPVPVTPSSPNWMLNLALGFILAGMAGAGVIVLLEVFDNGVRSEADVERELGAGHIASVPMLARARFGR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQGGGEGHPYDYVRENPLSGIAESFRVIRSAILLSNLDKVHKVVAITSALPGEGKTTTTYSLGRISAMSGSKTIILDCDL
                                              TSALPGEGKTTTTYSLGRISAMSGSKTIILDCDL
                                                     GKT                 IILDCDL
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRRLLTKAAAPDAQKGLMEVLAGEATLDEVLMDDAEPGLHILPVVESQFTPRDVFSSDAFKSLLAVLRQRYDLVLIDTAP
RRRLLTKAAAPDAQKGLMEVLAGEATLDEVLMDDAEPGLHILPVVESQFTPRDVFSSDAFKSLLAVLRQRYDLVLIDTAP
R                                                                        VLIDTAP
       570       580       590       600       610       620       630         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
VLAVTDTRVIAARADAVVVSVKWKTTPREAAASAIDILRDVNANVLGVALSQVDMNAQARYGYEGSSYYYKNYRSYYSG
VLAVTDTRVIAARADAVVVSVKWKTTPREAAASAIDILRDVNANVLGVALSQVDMNAQARYGYEGSSYYYKNYRSYYSG
                                                            YGYEGSSYYYKNYRSYY  
© 1998-2019