BYKdb

Annotate results for A0A0P7ZZE4

A0A0P7ZZE4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P7ZZE4
DOMAINcd126/310TSPLPGSGKTTTSINLAVALARQVDLRIILIDLDMRRPAVARSLGISGKTGVAPVLEGRE
SFGRQARRLGDNLAIAMNFAPLRDPSDLFLRARTSEVLDEIEATYRPDLILFDMPPLLVN
DDASAFLRNVDCALMVAEAGATTISQVDVCEKELAEQTNVLGVVLNKCRFFSDGYYRYYQ
AYGDD
SITE-173/-175GKT
SITEWalker A'154/161ILIDLDMR
SITEWalker B235/241ILFDMPP
SITEY Cluster300/307YYRYYQAY
SITEWalker A133/135GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERLKAALDKARETRAATAASAPATAARANPAAKPAPRGNGHASADAGAARRPQAAGSEPAPSTGSSGAVEAAWAEIQTS


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIDPRRLVKRRLISFGRQAEATAFDVLRTKMLQVTGANGWKRVAITSPLPGSGKTTTSINLAVALARQVDLRIILIDLDM
                                             TSPLPGSGKTTTSINLAVALARQVDLRIILIDLDM
                                                    GKT                  ILIDLDM
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRPAVARSLGISGKTGVAPVLEGRESFGRQARRLGDNLAIAMNFAPLRDPSDLFLRARTSEVLDEIEATYRPDLILFDMP
RRPAVARSLGISGKTGVAPVLEGRESFGRQARRLGDNLAIAMNFAPLRDPSDLFLRARTSEVLDEIEATYRPDLILFDMP
R                                                                         ILFDMP
       250       260       270       280       290       300       310
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLLVNDDASAFLRNVDCALMVAEAGATTISQVDVCEKELAEQTNVLGVVLNKCRFFSDGYYRYYQAYGDD
PLLVNDDASAFLRNVDCALMVAEAGATTISQVDVCEKELAEQTNVLGVVLNKCRFFSDGYYRYYQAYGDD
P                                                          YYRYYQAY   
© 1998-2019