BYKdb

Annotate results for A0A0P8UZR7

A0A0P8UZR7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P8UZR7
DOMAINcd42/234TSPGPGEGKSTTIVNLAVTMAQNDKRVLLIDCDLRKPRIHKNFGISNSKGLTTILSENID
YKEILHSIGIGLQLDVLTSGPIPPNPSELLGTKKMKAFLEKVEADYDIVLIDSPPVGMVT
DAAVLSTITDGVILVCAAGQSIIEGAKNAKALLQKVKANILGVVLTKVPIGDGKYYKYHY
YSYYYDYFNDENN
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDCDLR
SITEWalker B150/156VLIDSPP
SITEY Cluster216/228YYKYHYYSYYYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQIRLVTQENPKSPVAEAFRTLRTNIQFSNVDKELKSILITSPGPGEGKSTTIVNLAVTMAQNDKRVLLIDCDLRKPRI
                                         TSPGPGEGKSTTIVNLAVTMAQNDKRVLLIDCDLRKPRI
                                                GKS                 LLIDCDLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKNFGISNSKGLTTILSENIDYKEILHSIGIGLQLDVLTSGPIPPNPSELLGTKKMKAFLEKVEADYDIVLIDSPPVGMV
HKNFGISNSKGLTTILSENIDYKEILHSIGIGLQLDVLTSGPIPPNPSELLGTKKMKAFLEKVEADYDIVLIDSPPVGMV
                                                                     VLIDSPP    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDAAVLSTITDGVILVCAAGQSIIEGAKNAKALLQKVKANILGVVLTKVPIGDGKYYKYHYYSYYYDYFNDENNEEKGRR
TDAAVLSTITDGVILVCAAGQSIIEGAKNAKALLQKVKANILGVVLTKVPIGDGKYYKYHYYSYYYDYFNDENN      
                                                       YYKYHYYSYYYDY            
        
....:...
RKKAEANA


© 1998-2019