BYKdb

Annotate results for A0A0P9C2V3

A0A0P9C2V3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P9C2V3
DOMAINcd44/225TSAHPGEGKTSTAANLAIVATQASKRVLLVDTDLRHPQLAQRFGVANEEGLTKVLRQGCD
AQDVIVPTEIPGLHVLPSGAVGLNSPSLLSSLAFTSLVNRLKSKYDLVVFDAPPVLPVSD
PLVLSRNVDGIVFVVDGRTTNRLVAQRALKELHKVNGTIIGGILNRGSFENDHSYYYGSS
DI
SITEWalker A51/53GKT
SITEWalker A'71/78LLVDTDLR
SITEWalker B151/157VVFDAPP
SITEY Cluster218/220YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPVKTSRAWPISQTHPESSYAESYRSILTNIELLSINVKSIMVTSAHPGEGKTSTAANLAIVATQASKRVLLVDTDLRHP
                                           TSAHPGEGKTSTAANLAIVATQASKRVLLVDTDLRHP
                                                  GKT                 LLVDTDLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLAQRFGVANEEGLTKVLRQGCDAQDVIVPTEIPGLHVLPSGAVGLNSPSLLSSLAFTSLVNRLKSKYDLVVFDAPPVLP
QLAQRFGVANEEGLTKVLRQGCDAQDVIVPTEIPGLHVLPSGAVGLNSPSLLSSLAFTSLVNRLKSKYDLVVFDAPPVLP
                                                                      VVFDAPP   
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
VSDPLVLSRNVDGIVFVVDGRTTNRLVAQRALKELHKVNGTIIGGILNRGSFENDHSYYYGSSDI
VSDPLVLSRNVDGIVFVVDGRTTNRLVAQRALKELHKVNGTIIGGILNRGSFENDHSYYYGSSDI
                                                         YYY     
© 1998-2019