BYKdb

Annotate results for A0A0P9KXD8

A0A0P9KXD8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0P9KXD8
DOMAINtad15/270ARIDLATVLRILFDQKALVLWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTP
EVSGKPLSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDG
ALAEPLWGLSHYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAV
NRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAEAGRDSGIIYLSIED
QDAQRANRILDQISRL
DOMAINcd564/752SSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVINPTRIRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDCAA
YGYNYHPAP
SITEWalker A571/573GKS
SITEWalker A'591/598LLIDADMR
SITEWalker B671/677ILVDTPP
SITEY Cluster739/748YDCAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVMSRPTLDYYQDARIDLATVLRILFDQKALVLWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
              ARIDLATVLRILFDQKALVLWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
AGRDSGIIYLSIEDQDAQRANRILDQISRL                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGMPVYASLPYSRQQERLEKRGKNTRGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
   SSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
          GKS                 LLIDADMR                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
                              ILVDTPP                                           
       730       740       750   
....:....|....:....|....:....|...
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAP 
                  YDCAAYGYNY     

© 1998-2019