BYKdb

Annotate results for A0A0P9LE74

A0A0P9LE74 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P9LE74
DOMAINcd201/389SSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAARRR
CADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTD
ASLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAA
YGYDYKSAP
SITEWalker A208/210GKS
SITEWalker A'228/235LLIDADMR
SITEWalker B308/314ILVDTPP
SITEY Cluster376/385YDSAAYGYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRGADTEHPTYRSLMSQMNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDILRAGSIGNVRVI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DHANANTEKPVKPMKKLIVLMATLIGALVAVMIIFVRQAFYRGVESAEVIEGLGMPVYASLPYSRQQDRLEKNSKSAPTR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGTRLLSAAAPDDLAIESLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLH
                                        SSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLH
                                               GKS                 LLIDADMR     
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIFGLQPKHGLSDTLAARRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTD
RIFGLQPKHGLSDTLAARRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTD
                                                                   ILVDTPP      
       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAPR
ASLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAP 
                                                       YDSAAYGYDY     
© 1998-2019